PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G044752_P01
Common NameHB53, LOC100285975
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 227aa    MW: 25048.6 Da    PI: 8.9204
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G044752_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-1976130256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  GRMZM2G044752_P01  76 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTK 130
                        788899***********************************************98 PP

2HD-ZIP_I/II130.28.1e-4276165191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  GRMZM2G044752_P01  76 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKEVQELR-AL 165
                        69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.85E-1967133IPR009057Homeodomain-like
PROSITE profilePS5007117.31372132IPR001356Homeobox domain
SMARTSM003897.4E-1874136IPR001356Homeobox domain
PfamPF000466.2E-1776130IPR001356Homeobox domain
CDDcd000862.23E-1676133No hitNo description
Gene3DG3DSA:1.10.10.606.9E-1976130IPR009057Homeodomain-like
PRINTSPR000313.9E-6103112IPR000047Helix-turn-helix motif
PROSITE patternPS000270107130IPR017970Homeobox, conserved site
PRINTSPR000313.9E-6112128IPR000047Helix-turn-helix motif
PfamPF021832.2E-11132166IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.7E-25132175IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MMERVEDLGL SLSLSSSLAS PRTHHVATML LRAPEKRFLE MPLLLPAKRT TEVTGEDGLR  60
GGSDEEDGGC GIDGSRKKLR LSKDQSAVLE DSFREHPTLN PRQKAALAQQ LGLRPRQVEV  120
WFQNRRARTK LKQTEVDCEY LKRCCETLTE ENRRLQKEVQ ELRALKLVSP HLYMHMSPPT  180
TLTMCPSCER VSSSNGNSAA ATAAARARAG AGAGAIVCHP IDRATST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17480SRKKLRL
2124132RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.213390.0meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G044752
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G044752_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9749800.0EU974980.1 Zea mays clone 462177 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152336.11e-167uncharacterized protein LOC100285975
SwissprotQ01I231e-102HOX17_ORYSI; Homeobox-leucine zipper protein HOX17
TrEMBLA0A3L6G2G61e-165A0A3L6G2G6_MAIZE; Homeobox-leucine zipper protein HOX17
TrEMBLB6UCL51e-165B6UCL5_MAIZE; HB transcription factor
STRINGGRMZM2G044752_P011e-166(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.13e-74homeobox-leucine zipper protein 3
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]