PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G044576_P01
Common NameLOC100304362, ZEAMMB73_688337
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GATA
Protein Properties Length: 375aa    MW: 39406.3 Da    PI: 5.6515
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G044576_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.87.5e-19246280135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        C++C t kTp+WR gp g+ktLCnaCG++y++ +l
  GRMZM2G044576_P01 246 CVHCDTDKTPQWRTGPMGPKTLCNACGVRYKSGRL 280
                        *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.782240276IPR000679Zinc finger, GATA-type
SMARTSM004011.2E-18240290IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.8E-15241277IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577167.6E-16242303No hitNo description
CDDcd002023.94E-15245292No hitNo description
PfamPF003201.4E-16246280IPR000679Zinc finger, GATA-type
PROSITE patternPS003440246271IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MEAAASAEYG YYGGGAGPHE TKTAGCGDHF VVDDLLALPP YDDEEEGATG ETPLCLQPVK  60
EEEGGLGNFS ADSSIVVTAI DSCSNSFSRL ADDDFPGEFY EPYDQLVELE WLSNYMGEGE  120
ETFAAEDLEK LKLISGGFSP AAVNVSAPAP VGVASAASAT QSGMFLPVPA KARSKRSRAA  180
PGNWSSRLVV LPPTPASPPA PAASMAISPS ESGISAQQAF RAKKPPPSKK KDAAAPAPAP  240
AEGRRCVHCD TDKTPQWRTG PMGPKTLCNA CGVRYKSGRL VPEYRPAASP TFVMSKHSNS  300
HRKVLELRRQ KEVVVQQPPH VMGGAGGPAG GLMRMQSAML LDGPVAAVSS SSPIVGGDEF  360
LIHQHLGTAD YRQRI
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G044576
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G044576_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9631210.0EU963121.1 Zea mays clone 257954 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001159272.20.0uncharacterized protein LOC100304362
TrEMBLK7VQ400.0K7VQ40_MAIZE; GATA transcription factor
STRINGGRMZM2G044576_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-44GATA transcription factor 12