PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G042218_P01
Common NameLOC100273698, ZEAMMB73_862004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 338aa    MW: 36139.2 Da    PI: 4.4946
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G042218_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.61.2e-373289562
             zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       a +cprCds ntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+r+n++++
  GRMZM2G042218_P01 32 APSCPRCDSPNTKFCYYNNYSLTQPRYFCKGCRRYWTRGGSLRNVPVGGGCRRNRRAK 89
                       568***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-331487IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8263387IPR003851Zinc finger, Dof-type
PfamPF027013.9E-313387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MLSSHHEAML PYAPPSLLVD RRYRQQQAGE AAPSCPRCDS PNTKFCYYNN YSLTQPRYFC  60
KGCRRYWTRG GSLRNVPVGG GCRRNRRAKS SVRSAFGGGH RFVQGPVVRP DLVLEGMVSN  120
SNPAHEMPAA ADGSTIDLAM LYAKFLDHHP PAPEEGLGSA VTPELAVALA GPERLDEALF  180
DTFSDLSPPA GVLAAPPVQF DPPCGHDDGF DDWSSGGPVS SAGPSSTAST ATATTCIPPC  240
ADVSVHAAFG EEFNFAKDQS CLLFDSLGLP TDDVGDLSSS SWRSIVPGLS TLEDTEYDLL  300
DSSFPDDALS LHEGMVSGTD HDCWSVVDCQ GLEALYMP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17386RNVPVGGGCRRNRR
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G042218
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G042218_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0416550.0BT041655.1 Zea mays full-length cDNA clone ZM_BFb0026B04 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141582.10.0Dof zinc finger protein DOF1.2
TrEMBLB4FX170.0B4FX17_MAIZE; Dof zinc finger protein DOF1.2
TrEMBLK0D9N50.0K0D9N5_MAIZE; DOF38 C2C2-DOF type transcription factor (Fragment)
STRINGGRMZM2G042218_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-38Dof family protein