PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G041818_P01
Common NameZm.17503
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GeBP
Protein Properties Length: 362aa    MW: 38888.3 Da    PI: 7.1031
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G041818_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57384.12e-2681175297
             DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelsk 93 
                        +fqr+wse+De+ +LqGl+ +  ++g     d++ fy+ +++s+   +++ ql+eK+rrLK+Kf+ ++++++ g +p+  ++hd+++++l++
  GRMZM2G041818_P01  81 KFQRIWSESDELRFLQGLLGC-GTQGLVFPRDLNVFYDRFSESMPQPYTRAQLSEKLRRLKNKFRSMSARVAGGIDPARLAPHDRDVLHLCS 171
                        79*******************.667878888************************************************************* PP

             DUF573  94 kiWg 97 
                        ++W+
  GRMZM2G041818_P01 172 RLWD 175
                        ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-2382175IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MASDQQALPV PVPVPVPPNP NPTAPADLTP PSASAARKLP IKRRSPRPSS SPPSSSSPAS  60
SDPLRAPGGG GGSDQQQPPF KFQRIWSESD ELRFLQGLLG CGTQGLVFPR DLNVFYDRFS  120
ESMPQPYTRA QLSEKLRRLK NKFRSMSARV AGGIDPARLA PHDRDVLHLC SRLWDPANAA  180
TSPFAASAGT SGNKRRRSNP RGTPPDASGD SNSHDYNGIS SSAPGLFPDG SNGEDTFYLE  240
QESGQLGNHE GAALVADSKF DVVVQEQPEA VVTLPNGNNG IGSEMSAECK TVVPCSNEHR  300
MANAVLDVFE ECLREAKSNG IINGGNVESE LSKRWRAQRM DELDVLSRRL RLLVEYAAAA  360
GH
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.175030.0meristem| ovary| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G041818
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G041818_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8587800.0HQ858780.1 Zea mays clone UT1766 GEBP transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143574.10.0uncharacterized protein LOC100276272
TrEMBLF1DK220.0F1DK22_MAIZE; GEBP transcription factor (Fragment)
STRINGGRMZM2G041818_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Representative plantOGRP9800912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.23e-11DNA-binding storekeeper protein-related transcriptional regulator