PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G038252_P02
Common NameZm.28488
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family WOX
Protein Properties Length: 295aa    MW: 32686.5 Da    PI: 7.4175
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G038252_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.12.4e-21117177257
                        T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        r+R+++t+ ql++Le+ F + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  GRMZM2G038252_P02 117 RQRWQPTPMQLQILENIFDQgNGTPSKQRIKEITAELshhgQISETNVYNWFQNRRARSKR 177
                        89*****************99**************************************97 PP

2Wus_type_Homeobox100.61.1e-32116179265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RW Ptp Q++iLe+++++G  tP+k++i++itaeL+++G+i+++NV++WFQNr+aR+++kq
  GRMZM2G038252_P02 116 ARQRWQPTPMQLQILENIFDQGNGTPSKQRIKEITAELSHHGQISETNVYNWFQNRRARSKRKQ 179
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-17112182IPR009057Homeodomain-like
PROSITE profilePS5007114.949113178IPR001356Homeobox domain
SMARTSM003891.3E-14115182IPR001356Homeobox domain
SuperFamilySSF466891.8E-18116180IPR009057Homeodomain-like
PfamPF000464.0E-19117177IPR001356Homeobox domain
CDDcd000868.75E-15117179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MLSRAASRIA SNRRLAVRGS SGMEWVDRTK ASAAAAAAAA DERAGGAEGL AGYVKVMTDE  60
QMEVLRKQIS IYATICEQLV EMHRALTEHQ DTIAGIRFSN LYCDPQIIPG GHKITARQRW  120
QPTPMQLQIL ENIFDQGNGT PSKQRIKEIT AELSHHGQIS ETNVYNWFQN RRARSKRKQA  180
ASLPNNAESE AEVDEESLTD KKPKSDRSLQ DNKAMGAHNA DRISGMHHLD TDHDQIGGMM  240
YGCNDNGLRS SGSSGQMSFY GNIMPNPRID HFPGKVESSR SFSHLQHGEG FDMFG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170178RRARSKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.284880.0ear| meristem| root| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G038252
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G038252_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0639190.0BT063919.1 Zea mays full-length cDNA clone ZM_BFc0120C21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288365.10.0WUSCHEL-related homeobox 8-like
RefseqXP_008652675.10.0PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM31e-131WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A096QE430.0A0A096QE43_MAIZE; Uncharacterized protein
STRINGGRMZM2G038252_P020.0(Zea mays)
STRINGGRMZM2G069274_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18731639
MonocotsOGMP38983776
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.12e-57WUSCHEL related homeobox 13