PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G037128_P02
Common NameLOC100502488, ZEAMMB73_815554
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Trihelix
Protein Properties Length: 714aa    MW: 76269.5 Da    PI: 6.368
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G037128_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix100.31.6e-31539623186
           trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                        rW+k+ev aLi++r+ +e r+++  lk+plWeevs++m++ g+ rs+k+Ckekwen+nk+++k ke+ kkr + + +tcpyfd+l+
  GRMZM2G037128_P02 539 RWPKHEVEALIRVRTGLEGRFQEPGLKGPLWEEVSARMAAAGYGRSAKRCKEKWENINKYFRKAKESGKKR-PAHAKTCPYFDELD 623
                        8********************************************************************98.99999*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.34532596IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.607.5E-4536595IPR009057Homeodomain-like
SMARTSM007170.0048536598IPR001005SANT/Myb domain
CDDcd122038.59E-30538603No hitNo description
PfamPF138376.2E-23538625No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MQSGYGGVSE FQQFIMDGGF AMSAPPPPQQ QQPQTATAQE LGGPFRYQPL HHHALPPQHH  60
HHAPHMPPHF AHFGAAPPPP FTQQLLHQAA AAGHHHLQLF HEQQQQQHPH HHKPQPPHHH  120
HQQPPARWAP QPQHQQQQQQ PPQAQTHHHH HHHHLGFDVE AAVPESSGAA GAGRAAASGV  180
AAPPGVPPFL AAAMNFKLAV DAGGGSGATG GTDDALNDGG GGVGSGMMLH VGGGGGNDDD  240
EAATESRLRR WTGDEETSIK EPTWRPLDID YLHSSSSSKR TGKEKVATPE SPAPPAAAAN  300
YFKKGDDNAA AAVAAGGGNY KLFSELEAIY KPGSGGAGGA QTGSGSGLTG DDNAILEPAM  360
PDLPGITAED AGPQLITSET SAGEEAAAVV QPQPSADAAR RKRKRRRQQE QLSASASFFE  420
RLVQRLMEHQ ESLHRQFLEA MERRERDRAA RDEAWRRQEA DKFAREAAAR AQDRASAAAR  480
EAAIIAYLEK ISGESITLPP PASGDEDAAA AGKELVPYEG GDAAAAPEGG GSLHLSSSRW  540
PKHEVEALIR VRTGLEGRFQ EPGLKGPLWE EVSARMAAAG YGRSAKRCKE KWENINKYFR  600
KAKESGKKRP AHAKTCPYFD ELDRLYSRLG QAKQASSELL DAVVKYPDVR YGPPGFGMDR  660
EQASGGGGNN NNTNNEGGQD GGAEDFDGEE DGIGKGRAGD GQDDEVESHG HEDE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1399404RRKRKR
2400405RKRKRR
3400406RKRKRRR
4401406KRKRRR
5402406RKRRR
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G037128
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G037128_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0883330.0BT088333.2 Zea mays full-length cDNA clone ZM_BFc0144A13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453128.10.0trihelix transcription factor GTL1
TrEMBLK7UTA00.0K7UTA0_MAIZE; Trihelix transcription factor GTL2
STRINGGRMZM2G037128_P020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63993547
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-38Trihelix family protein