PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G035944_P02
Common NameLOC100194214, TCP7, ZEAMMB73_120862
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TCP
Protein Properties Length: 275aa    MW: 29585.3 Da    PI: 9.4114
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G035944_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.25.5e-2956124371
                TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssas 71 
                        g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl +a+++i++l+ ++++++ 
  GRMZM2G035944_P02  56 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLLDAAQHEIDKLPPLQFPPQA 124
                        78*************************************************************998882 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.68857115IPR017887Transcription factor TCP subgroup
PfamPF036341.8E-2657118IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MISGNLTNED LGAGRTKAEG PTTAARAVAK SPVLPSSRHW PPSTESRIVR VSRVFGGKDR  60
HSKVRTVKGL RDRRVRLSVP TAIQLYDLQD RLGLSQPSKV VDWLLDAAQH EIDKLPPLQF  120
PPQAAQDLVA HLPPPSMVAP FAADRAEADG DKRHCHAGVK GLMGLNNSIR LVNATMPLAH  180
GLYYTPGESW TGTNADDAAA HDHQTVAHGH SPFSSLLSLA APGPQLVFYS SEGGGFTMKE  240
EATGYQFPVQ NSLDHSQGQL SLSSARSFLR PGNQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-1962116155Putative transcription factor PCF6
5zkt_B2e-1962116155Putative transcription factor PCF6
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G035944
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G035944_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0366940.0BT036694.1 Zea mays full-length cDNA clone ZM_BFb0132C18 mRNA, complete cds.
GenBankBT0689420.0BT068942.2 Zea mays full-length cDNA clone ZM_BFc0170I14 mRNA, complete cds.
GenBankBT0692790.0BT069279.2 Zea mays full-length cDNA clone ZM_BFc0043P12 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001339734.10.0uncharacterized protein LOC100194214
TrEMBLB4FHV60.0B4FHV6_MAIZE; TCP transcription factor
STRINGGRMZM2G035944_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.11e-35plastid transcription factor 1