PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G035156_P01
Common NameLOC103631776, Zm.28335
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bHLH
Protein Properties Length: 92aa    MW: 10358.6 Da    PI: 7.3653
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G035156_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH23.31.1e-0720591554
                       HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                       +i +  ++L++llP+a  +++ ++  a +L+++++YI++L
  GRMZM2G035156_P01 20 QISDLVSKLQDLLPEARLQSNARVPSARVLQETCNYIRNL 59
                       789999*********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.107.7E-9378IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.442559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474593.27E-91881IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000109.1E-52059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MSNRRSRSRQ SGSSRITEEQ ISDLVSKLQD LLPEARLQSN ARVPSARVLQ ETCNYIRNLH  60
QEVDDLSERL SELLATSDMS SAQAAVIRSL LM
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G035156
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G035156_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0695698e-81AK069569.1 Oryza sativa Japonica Group cDNA clone:J023022K12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008651476.11e-58PREDICTED: transcription factor ILI6
SwissprotB8APB52e-45ILI6_ORYSI; Transcription factor ILI6
SwissprotQ0DUR22e-45ILI6_ORYSJ; Transcription factor ILI6
TrEMBLA0A096QCD42e-58A0A096QCD4_MAIZE; Uncharacterized protein
STRINGGRMZM2G035156_P014e-58(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18771240
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.14e-32bHLH family protein