PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G031905_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TCP
Protein Properties Length: 144aa    MW: 16009 Da    PI: 10.4412
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G031905_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP70.17.4e-2298143348
                TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdskti 48 
                         ++d hski T++g  dRR+Rls+ +a++fF+Lqd+LGfdk+skt+
  GRMZM2G031905_P01  98 FRTDWHSKIRTAQGVHDRRMRLSVGVAREFFALQDRLGFDKASKTV 143
                        689******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.8E-2099143IPR005333Transcription factor, TCP
PROSITE profilePS5136923.95199144IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MGPPGSAHSL PDSGCAQEKI GFRWRQLYLP PLTPPSPSSP LPDPDNHTAQ IRIHLVQHDR  60
GYRISASEGE RELPSNGLPP VVDDAGNQAA TVLRKRPFRT DWHSKIRTAQ GVHDRRMRLS  120
VGVAREFFAL QDRLGFDKAS KTVN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.398041e-96tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G031905
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G031905_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9614982e-94EU961498.1 Zea mays clone 235951 teosinte branched1 protein mRNA, complete cds.
GenBankKJ7277622e-94KJ727762.1 Zea mays clone pUT5707 TCP transcription factor (TCP11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148951.29e-41teosinte branched1 protein
TrEMBLA0A060D6L22e-39A0A060D6L2_MAIZE; TCP transcription factor (Fragment)
STRINGGRMZM2G031905_P011e-102(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40523172
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18550.21e-18TCP family protein