PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G028608_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 607aa    MW: 66678.5 Da    PI: 6.4672
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G028608_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.71.8e-922285992374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         + Ll+cA+a++s++ + a  lLar++ ++s  gd++qRla+ f+e+L+ rl++++s  y++ +  ++s +     l+a+++f   + +l +
  GRMZM2G028608_P01 228 HSMLLHCADALASNNRHSAADLLARIRRHSSLCGDATQRLAHWFAEGLELRLNGTGSLHYRSSSLMAKSASCAGAPLKAQQFFMASCCFLPV 319
                        678***************************************************9999999999999998899******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        s l aN++I++a++g +++Hi+ +++++GlQW++Ll+ La R++gpp++R+Tg++ p++g   ++ +ee g+r +  A++lgvpf+f+  +a
  GRMZM2G028608_P01 320 SILFANKTIYNAAAGRKKLHIVHYGLEHGLQWASLLRWLAHREGGPPEVRLTGIDVPQPGfrPARLIEEAGRRVHACARRLGVPFRFRG-IA 410
                        ***********************************************************9999999***********************.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +r e+++  +L ++p+E+l+++++++  +l des++ +     vL ++++++P v+v++  +a+++++ F++rf e l+ ++alfd+++a l
  GRMZM2G028608_P01 411 SRPEAVRAGDLGIDPDEVLVICSMFHFRTLADESTDDPI--GVVLGAIREMRPAVFVHAVLNASYSTAFFATRFRELLYNFTALFDMMDAIL 500
                        ******************************977776666..*************************************************** PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        pr++  r   Ere+l+r +vn++acega r + ++++++W++r ++aG++++pl+ +++ + +  +++ + +g+ + e++++l++gWk+r L
  GRMZM2G028608_P01 501 PRDNGRRLLFEREVLARCAVNAIACEGAGRAHHTRSYKQWQARSRRAGLRQLPLDGDVVRTLRDKVSREYHEGFVITEDQQWLLQGWKGRVL 592
                        ******************************************************************************************** PP

               GRAS 368 vsvSaWr 374
                        +++S W+
  GRMZM2G028608_P01 593 YAISTWT 599
                        ******5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.965201579IPR005202Transcription factor GRAS
PfamPF035146.4E-90228599IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0009074anatomystyle
PO:0020040anatomyleaf base
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MEPTAAQPRS FSNLSPTPDL DGSQDDNVLP FISRMLMEDD GVDEFLYQQY PDHNPALLQT  60
QQLFAQVLSD TSTNALTALQ AVAHGSDLQD PSSLNSTATG AVEPASILLP AEGSSCCKDA  120
VSMAFFRGME EANKFLPGDG GGGYTVDCRG RKKRLDGDDE GEGRSSKQMA ADGEESEESA  180
AREMLDRLML NGDDEPMLAD IQELRAAMDM AKTLPGRPGG RAHGVDLHSM LLHCADALAS  240
NNRHSAADLL ARIRRHSSLC GDATQRLAHW FAEGLELRLN GTGSLHYRSS SLMAKSASCA  300
GAPLKAQQFF MASCCFLPVS ILFANKTIYN AAAGRKKLHI VHYGLEHGLQ WASLLRWLAH  360
REGGPPEVRL TGIDVPQPGF RPARLIEEAG RRVHACARRL GVPFRFRGIA SRPEAVRAGD  420
LGIDPDEVLV ICSMFHFRTL ADESTDDPIG VVLGAIREMR PAVFVHAVLN ASYSTAFFAT  480
RFRELLYNFT ALFDMMDAIL PRDNGRRLLF EREVLARCAV NAIACEGAGR AHHTRSYKQW  540
QARSRRAGLR QLPLDGDVVR TLRDKVSREY HEGFVITEDQ QWLLQGWKGR VLYAISTWTA  600
DDGLAGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-342315988374GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G028608
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G028608_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978027.10.0PREDICTED: scarecrow-like protein 33
TrEMBLA0A096Q8260.0A0A096Q826_MAIZE; Uncharacterized protein
STRINGGRMZM2G028608_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1983022
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.11e-119GRAS family protein