PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G028438_P01
Common NameGRAS76, ZEAMMB73_414510, Zm.43192
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 607aa    MW: 63032.1 Da    PI: 8.5031
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G028438_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS298.12.3e-912376072374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalklfsevsPi 90 
                        ++lL e+A av++g++++a a La l++ a+p+gd+ qRl+a+++ AL++r+ r  +  +     ++         +e+ a  +l+++vsP+
  GRMZM2G028438_P01 237 RQLLSEAAAAVADGNHAAAAAHLAVLKTAANPRGDAEQRLVAMMAGALSSRIRR--PPAS----HQHL---AglcGAEQRAEWQLLQHVSPC 319
                        689***************************************************..2222....2222...1234777888889******** PP

               GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfef 178
                        + ++   aN aIl+av+ ++++H iDfd+s  +Q  aL+++LasR+     l++T+v +p+s      +++l +tg+rL++ A++ gv+f+f
  GRMZM2G028438_P01 320 FGLALHGANLAILDAVADQRAIHLIDFDVSV-AQHTALIDSLASRRVAGTCLKVTAVTDPTSPftpaLAQALAATGQRLKEHARQAGVEFRF 410
                        *****************************96.7**************************9988899999*********************** PP

               GRAS 179 nvlvak.rledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                        +++ +     + + ++L +++ gEal+Vnl+++l r++desvs +++rd++L+ v++l+P+vv++veqe+  n++++++rf++a+ +y a++
  GRMZM2G028438_P01 411 RAVSCVaGEVEASRSRLGCDEtGEALVVNLAFALSRVPDESVSPANPRDALLRGVRGLRPRVVTLVEQELGANTAPLAARFADACAHYGAVL 502
                        **94441333457999****99********************************************************************** PP

               GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                        +sl+a+l+r+s +r+  E++ l+ ++ n+va eg +r+er+e ++kWr+r+++aG++pv++++ +a+ +k  l   +  g+ v+ +sg l +
  GRMZM2G028438_P01 503 ESLDATLGRDSAQRARAEAA-LASKAANAVAREGPDRVERCEVFGKWRARFGMAGLRPVAIGQGVADRVKGRLGPAARPGFDVKLDSGRLAI 593
                        *******************9.9999******************************************************************* PP

               GRAS 361 gWkdrpLvsvSaWr 374
                        gW++r ++++SaWr
  GRMZM2G028438_P01 594 GWMGRVVTVASAWR 607
                        *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.368210587IPR005202Transcription factor GRAS
PfamPF035148.0E-89237607IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MEPAGAPWCD PGRGYGAGSA AEAPTLKGQQ PQQLLLTPPR QDGAALKRSL GDVERWQQAL  60
YLRAVRQRVA VAAQSQMAHP PTDVGPVLAG ATASPASYGF SRPPSSPFAG LSPQPSSTLS  120
SLTTASHVET PPLLQRHTVA ARELVLLQEL EKHLLDDGDG EAEATGSACG STVTSSAWGD  180
TIQELNSLTA APLASLPNNY SNTVPAMSRS PPSNSSSSTA SSAASSSPAA STTASSRQLL  240
SEAAAAVADG NHAAAAAHLA VLKTAANPRG DAEQRLVAMM AGALSSRIRR PPASHQHLAG  300
LCGAEQRAEW QLLQHVSPCF GLALHGANLA ILDAVADQRA IHLIDFDVSV AQHTALIDSL  360
ASRRVAGTCL KVTAVTDPTS PFTPALAQAL AATGQRLKEH ARQAGVEFRF RAVSCVAGEV  420
EASRSRLGCD ETGEALVVNL AFALSRVPDE SVSPANPRDA LLRGVRGLRP RVVTLVEQEL  480
GANTAPLAAR FADACAHYGA VLESLDATLG RDSAQRARAE AALASKAANA VAREGPDRVE  540
RCEVFGKWRA RFGMAGLRPV AIGQGVADRV KGRLGPAARP GFDVKLDSGR LAIGWMGRVV  600
TVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-302376076375GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G028438
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G028438_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9570740.0EU957074.1 Zea mays clone 1581966 chitin-inducible gibberellin-responsive protein 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001147939.10.0chitin-inducible gibberellin-responsive protein 2
TrEMBLB6SWF90.0B6SWF9_MAIZE; Chitin-inducible gibberellin-responsive protein 2
STRINGGRMZM2G028438_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7599918
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.15e-62SCARECROW-like 8
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]