PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G027976_P01
Common NameLOC100272663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 278aa    MW: 29383.4 Da    PI: 6.9723
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G027976_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.41.1e-11155206455
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++  l ++
  GRMZM2G027976_P01 155 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQNEVSALSPRVAFLDQQ 206
                        5999***********************************9999887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-15152216IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.933154206IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.7E-12156210No hitNo description
SuperFamilySSF579595.56E-12156210No hitNo description
PfamPF001703.6E-10156203IPR004827Basic-leucine zipper domain
CDDcd147034.21E-23157208No hitNo description
PROSITE patternPS000360159174IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MAQLPPRVPT AVHRWPEGGH HGAAAWADDF AEFAASRRGA HRRSLSDSVA FVEVAPAAGE  60
FDRLDDDQLM SMFPDEAAAG GGGGGSSAAG SENNGGSSDS YGDRRGGGGP AAGGTSTTTS  120
CNGFDGGEHN EAADAQATGQ AAAAAAASTE LIRDPKRVKR ILANRQSAQR SRVRKLQYIS  180
ELERSVTTLQ NEVSALSPRV AFLDQQRTIL TVGNSHLKQR IAALAQDKIF KDAHQEALKK  240
EIERLRQVYE QQNLKMSAGA AASDHGPPPV RAEKELMS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.322870.0endosperm| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G027976
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots and panicles. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G027976_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0391360.0BT039136.1 Zea mays full-length cDNA clone ZM_BFb0374H13 mRNA, complete cds.
GenBankBT0872850.0BT087285.1 Zea mays full-length cDNA clone ZM_BFb0029G15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001140593.10.0uncharacterized protein LOC100272663
SwissprotQ5JMK61e-113BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLB4FPU80.0B4FPU8_MAIZE; BZIP transcription factor
STRINGGRMZM2G027976_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.12e-55bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]