PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G025685_P02
Common NameZm.79780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HSF
Protein Properties Length: 88aa    MW: 10223.6 Da    PI: 5.5465
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G025685_P02genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.82.1e-252785260
                       HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
       HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                       Fl+k+y++++d+ +++++sw ++ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y
  GRMZM2G025685_P02 27 FLTKTYQLVDDPCTDHIVSWGDDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY 85
                       9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.3E-271985IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.2E-202388IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467853.67E-232685IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.8E-212785IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.1E-152750IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.1E-156577IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.1E-157888IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MAFLVERCGE MVVSMESPHA KPVPAPFLTK TYQLVDDPCT DHIVSWGDDD TTFVVWRPPE  60
FARDLLPNYF KHNNFSSFVR QLNTYVRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5v_D1e-1623852687Heat shock factor protein 1
5d5v_B1e-1623852687Heat shock factor protein 1
5d5u_B1e-1623852687Heat shock factor protein 1
2ldu_A2e-1623851778Heat shock factor protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.797801e-137ear| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G025685
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G025685_P02
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0541481e-141BT054148.1 Zea mays full-length cDNA clone ZM_BFb0133K13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463264.11e-56hypothetical protein SORBIDRAFT_02g040790
SwissprotQ7XHZ05e-54HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBLA0A096Q6751e-61A0A096Q675_MAIZE; Uncharacterized protein
STRINGGRMZM2G025685_P012e-58(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.14e-43heat shock transcription factor B4