PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G024973_P01
Common Named9, LOC100127531, Zm.6402
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 625aa    MW: 65742.6 Da    PI: 5.0091
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G024973_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS451.55.3e-1382366211374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevsP 89 
                        lv++Ll+cAeav+++++++a+al++++  las++g +m+++aayf eALa+r++r        l+p ++   +  ++++a+ l   f+e +P
  GRMZM2G024973_P01 236 LVHALLACAEAVQQENFSAADALVKQIPVLASSQGGAMRKVAAYFGEALARRVYR--------LRPAPDG--SLLDAAFADLLhahFYESCP 317
                        689****************************************************........4444444..34444444433445****** PP

               GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                        +lkf+h+taNqaIlea++g++rvH++Df+i+qG+QWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l+++g++La+fA++++v+f+++ l
  GRMZM2G024973_P01 318 YLKFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQVGWKLAQFAHTIRVDFQYRGL 409
                        ******************************************************************************************** PP

               GRAS 182 vakrledleleeLrvkp.......gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                        va +l+dle+ +Lr +         E++aVn+v +lhrll+++++l++    vL +v+ ++P++v+vveqea+hns++Fl+rf+e+l+yys+
  GRMZM2G024973_P01 410 VAATLADLEPFMLRPEGggdtddePEVIAVNSVCELHRLLAQPGTLDK----VLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYST 497
                        *************555455555579*******************9999....**************************************** PP

               GRAS 267 lfdsleak...............lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk 343
                        +fdsle                 +++ + +++++++++lgr+i+n+vacegaer+erhetl +Wr rl+ +GF+pv+l+++a+kqa++ll+ 
  GRMZM2G024973_P01 498 MFDSLEGAgsgsgsgsgsgqptdASPPAGTDQVMSEVYLGRQICNIVACEGAERTERHETLVQWRGRLGGSGFEPVHLGSNAYKQASTLLAL 589
                        *****88789*********888877888**************************************************************** PP

               GRAS 344 vk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                        ++ +dgyrvee++g+l+lgW++rpL+++SaWr
  GRMZM2G024973_P01 590 FAgGDGYRVEEKDGCLTLGWHTRPLIATSAWR 621
                        *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011299.0E-3337116No hitNo description
PfamPF120411.4E-3537110IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098565.634210600IPR005202Transcription factor GRAS
PfamPF035141.8E-135236621IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006310anatomytassel floret
PO:0006340anatomyadult vascular leaf
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MKREYQNAGG NDGYRGSSKD KSMAAAAGAG EQEEEVDELL AALGYKVRSS DMADVAQKLE  60
QLEMAMGMGG ACPTADDGFV SHLATDTVHY NPSDLSSWVE SMLSELNAPP PPLPPATPAP  120
RLASTSSTVT SGAAAGAGYF DLPPAVDSSS STYALKPIPS PVAAASADPS PDSAREPKRM  180
RTGGGSTSSS SSSSSSMDGG RTRSSVVEAA PPATQAANGP AVPVVVVDTQ EAGIRLVHAL  240
LACAEAVQQE NFSAADALVK QIPVLASSQG GAMRKVAAYF GEALARRVYR LRPAPDGSLL  300
DAAFADLLHA HFYESCPYLK FAHFTANQAI LEAFAGCRRV HVVDFGIKQG MQWPALLQAL  360
ALRPGGPPSF RLTGVGPPQP DETDALQQVG WKLAQFAHTI RVDFQYRGLV AATLADLEPF  420
MLRPEGGGDT DDEPEVIAVN SVCELHRLLA QPGTLDKVLG TVRAVRPRIV TVVEQEANHN  480
SGTFLDRFTE SLHYYSTMFD SLEGAGSGSG SGSGSGQPTD ASPPAGTDQV MSEVYLGRQI  540
CNIVACEGAE RTERHETLVQ WRGRLGGSGF EPVHLGSNAY KQASTLLALF AGGDGYRVEE  600
KDGCLTLGWH TRPLIATSAW RVAAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-562366214375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.64020.0ear| endosperm| meristem| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G024973
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G024973_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9030730.0DQ903073.1 Zea mays dwarf plant9 (d9) mRNA, d9-B73 allele, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001296780.10.0DELLA protein DWARF8-like
SwissprotQ9ST480.0DWRF8_MAIZE; DELLA protein DWARF8
TrEMBLQ06F070.0Q06F07_MAIZE; Dwarf plant9 (Fragment)
STRINGGRMZM2G024973_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein
Publications ? help Back to Top
  1. Lawit SJ,Wych HM,Xu D,Kundu S,Tomes DT
    Maize DELLA proteins dwarf plant8 and dwarf plant9 as modulators of plant development.
    Plant Cell Physiol., 2010. 51(11): p. 1854-68
    [PMID:20937610]