PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G020799_P01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 176aa    MW: 20270.6 Da    PI: 7.0734
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G020799_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1391.8e-1285145363
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        e +r rr+ +NRe+ArrsR RK++++ eL   v  L + N++L ++l++    ++++  e+
  GRMZM2G020799_P01  85 EERRKRRMVSNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHAIRDCDRVLREN 145
                        56899***************************************99999888888777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-1283147IPR004827Basic-leucine zipper domain
PfamPF001702.1E-985144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.39285148IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-987160No hitNo description
SuperFamilySSF579591.75E-1187136No hitNo description
CDDcd147024.12E-1688139No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MYPAAEIASV PYLSPAASFK PHYHVATDDD GGFLYQQYSN LLLPHPPSYY QEVAYDQLVL  60
EASFPVGGNN RSNSESDEYQ RSVAEERRKR RMVSNRESAR RSRMRKQKQL SELWAQVVHL  120
RSTNRQLLDQ LNHAIRDCDR VLRENSQLRD EQTKLQQQLE MLPVDTTESG AMSPGS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
186107RRKRRMVSNRESARRSRMRKQK
299106RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1002901e-93meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G020799
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G020799_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1854720.0AC185472.4 Zea mays BAC clone CH201-257N23 from chromosome 5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008646194.11e-128bZIP transcription factor RISBZ3
TrEMBLA0A1D6HJ361e-127A0A1D6HJ36_MAIZE; Basic leucine-zipper 58
STRINGGRMZM2G020799_P011e-128(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Representative plantOGRP31041129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.13e-27basic leucine-zipper 42