PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G018254_P01
Common NameGRAS48, LOC100279519, ZEAMMB73_329052
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 648aa    MW: 71808 Da    PI: 6.0844
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G018254_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS320.72.9e-982756441373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cAeavs+g+   a++lL ++++++sp+gd+ qRla++f+++L+ rla+         +p++++    ++ l+a+ l  +v+ +  
  GRMZM2G018254_P01 275 LRTLLVHCAEAVSTGNRPGATELLRQIRQRSSPRGDASQRLAHCFAQGLELRLAG------TGAKPKRAP--AGVHLLKAYLLSMQVCCFRM 358
                        6789***************************************************......333343333..59999*************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        +++  +  aI +av+g ++vHi+D+++ +G++W+ Ll a a+R +gpp++RiTg++ p++g  s++++e  g+rL++fA+++gvpf+f+ +v
  GRMZM2G018254_P01 359 VAFKSCHMAISKAVAGRKKVHIVDYGVDHGFHWLLLLGAWATRVGGPPEVRITGIDFPQPGfrSATRTEGAGRRLSDFARQCGVPFKFRSIV 450
                        ************************************************************9******************************* PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                        a+++e++  e+L+++p+E+l+Vn  +   +l+d+++   +   +rd vL  + +++P+v+v+   +++hn++ F++rf eal yysalfd++
  GRMZM2G018254_P01 451 ATKWEMIFAEDLEIEPDEVLVVNGLFYFGKLMDDEGVDGDcpsPRDMVLGNISRMRPEVFVLYVDNSSHNAPFFATRFREALFYYSALFDMM 542
                        ********************************98764443344************************************************* PP

               GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                        +a+ pr+s++r+ vErellgr + nv++ceg+er+er et+++W+ r ++aG++++pl+ +++k  + l+++ + + + ++ ++++l++gWk
  GRMZM2G018254_P01 543 DATTPRDSDDRVLVERELLGRCALNVITCEGSERVERPETYRQWQVRCSRAGLRQLPLDPSTVKCLSDLVKEGYHKDFVIDVDQQWLLQGWK 634
                        ************************************************************************99888*************** PP

               GRAS 364 drpLvsvSaW 373
                        +r L+++S W
  GRMZM2G018254_P01 635 GRILYAMSTW 644
                        ********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.092249625IPR005202Transcription factor GRAS
PfamPF035141.0E-95275644IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MHPHHTHTHQ RETAMAPTPE DPAADDSEPF SPSIFLDLPP TPHPGDDGKD SMIDLHFIRR  60
LLMEDDDVQF QYADHHALLQ AAEEPFAQIL AGSAGSSVSG SATADTTAIY YPDGTGFHFH  120
QQTAGPTSTT GDDGVVTMDM LNRAFLKGME EANKFLPVVA SSTHTSLLCR DYASKHRVVD  180
GIGMPLFFQE SSGNNRRGRG CHHDDDGDDE ADTRSAKLIA PELEESGEVT DGVFLRGYEV  240
ALEKMNGLST NVPGAMSRQG QGRQQRSSGN EAVDLRTLLV HCAEAVSTGN RPGATELLRQ  300
IRQRSSPRGD ASQRLAHCFA QGLELRLAGT GAKPKRAPAG VHLLKAYLLS MQVCCFRMVA  360
FKSCHMAISK AVAGRKKVHI VDYGVDHGFH WLLLLGAWAT RVGGPPEVRI TGIDFPQPGF  420
RSATRTEGAG RRLSDFARQC GVPFKFRSIV ATKWEMIFAE DLEIEPDEVL VVNGLFYFGK  480
LMDDEGVDGD CPSPRDMVLG NISRMRPEVF VLYVDNSSHN APFFATRFRE ALFYYSALFD  540
MMDATTPRDS DDRVLVEREL LGRCALNVIT CEGSERVERP ETYRQWQVRC SRAGLRQLPL  600
DPSTVKCLSD LVKEGYHKDF VIDVDQQWLL QGWKGRILYA MSTWAADR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-432796448374GRAS family transcription factor containing p
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G018254
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G018254_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269520.0KJ726952.1 Zea mays clone pUT3646 GRAS transcription factor (GRAS48) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001145990.10.0uncharacterized protein LOC100279519
SwissprotO809331e-123SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK7TQ870.0K7TQ87_MAIZE; GRAS transcription factor
STRINGGRMZM2G018254_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1981222
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-124GRAS family protein