PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G013398_P04
Common Namecl9757_1b, ZEAMMB73_488664, Zm.5652
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CO-like
Protein Properties Length: 408aa    MW: 43827.8 Da    PI: 5.1539
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G013398_P04genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.63.9e-06445540
           zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                        C+ ++e++   +C+++   lC +C  + H+       Ht++
  GRMZM2G013398_P04  4 LCDFCGEHRSMVYCRSDAASLCLSCDRNVHSAnalsrrHTRT 45
                       6*****************************657888889876 PP

2zf-B_box22.52.4e-074789541
           zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                        C+++ ++++   C   +  lC++C  ++H        H++++
  GRMZM2G013398_P04 47 LCDRCASQPAMVRCLAENASLCQNCDWNGHIAgsssagHKRQT 89
                       7*****************************3256677788765 PP

3CCT62.91e-21351394144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        R+ al+RYkeK+ +RkF+KkirY+sRKa+A+ R+RvKGrFvk+ 
  GRMZM2G013398_P04 351 RDSALTRYKEKKMRRKFDKKIRYASRKARADVRKRVKGRFVKAG 394
                        899**************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.0E-10147IPR000315B-box-type zinc finger
PROSITE profilePS501199.783147IPR000315B-box-type zinc finger
CDDcd000214.76E-8447No hitNo description
PROSITE profilePS501199.0444390IPR000315B-box-type zinc finger
CDDcd000211.18E-54790No hitNo description
SMARTSM003360.224890IPR000315B-box-type zinc finger
PROSITE profilePS5101715.15351393IPR010402CCT domain
PfamPF062039.7E-17351393IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGALCDFCGE HRSMVYCRSD AASLCLSCDR NVHSANALSR RHTRTLLCDR CASQPAMVRC  60
LAENASLCQN CDWNGHIAGS SSAGHKRQTI NCYSGCPSSA ELSRIWSFVS DIPNVAPEPN  120
CEQGISMMSI SDSGVSNQDN AAGDSILLDI ASATLVSDIG TCDKLLVGSS SGAGVNLLPL  180
ATGQTETAGS VDSTPDKVPY TPDKDMFSKD SIYEDFCVDD ADLAFENYEE LFGTSHIQTE  240
QLFDDAGIDI YFEMKEAPAG NSTEQSKLKQ PANSNAVSAD SGMSNPGVKG DSSVCTPLRQ  300
ARSSLSLSFA GLTGESSAGD HQDCVVSSLL LMGEPPWQPP GPEGSIAGGS RDSALTRYKE  360
KKMRRKFDKK IRYASRKARA DVRKRVKGRF VKAGEAYDYD PLCQTRSY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.56520.0endosperm| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G013398
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G013398_P04
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278500.0KJ727850.1 Zea mays clone pUT5895 C2C2-CO-like transcription factor (COL6) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658624.10.0uncharacterized protein LOC100282916 isoform X3
SwissprotQ9SSE51e-121COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLK7VG920.0K7VG92_MAIZE; Zinc finger protein CONSTANS-LIKE 9
STRINGGRMZM2G013398_P040.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20793788
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.15e-93B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]