PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G011832_P01
Common NameDOF32, LOC103643630, Zm.130972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 360aa    MW: 36276.4 Da    PI: 7.9739
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G011832_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.1e-393797262
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       +e+ l+cprCds ntkfCyynnyslsqPryfCk+CrryWtkGGalrnvPvGgg+rknk+s+
  GRMZM2G011832_P01 37 PEQGLRCPRCDSPNTKFCYYNNYSLSQPRYFCKTCRRYWTKGGALRNVPVGGGCRKNKRSR 97
                       67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027018.1E-333995IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-254194IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4324195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007031developmental stagemid whole plant fruit ripening stage
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MASTTGDDAV GTRKGGTGAG GTPPPTTQTQ TQPPPPPEQG LRCPRCDSPN TKFCYYNNYS  60
LSQPRYFCKT CRRYWTKGGA LRNVPVGGGC RKNKRSRSAA AVAAAAAAAA AASSSRLSLN  120
LPPEAAAAAD QQAARLGFLG AHHPVASSTI DGGGPAAADY HHQQAGAAAV GMIALPRLHA  180
PGVVGQYVPF GEWHPGTAGD VVTGGAAVSS SSSSIASSIE SLSFINQDLH WKLQQQRLAT  240
MFLGAPTSAA AAAAAHADSA AHVGGAFMQM SVAESTMTMP PPPLATSWFM DSSCYALPSP  300
TMTAHASTAA AVAAATGTCN VVNGAGAGDD DSAASNNNNN CGPGSAIQSW GDMSAFAMLP
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G011832
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G011832_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269770.0KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008665016.10.0dof zinc finger protein DOF5.7
TrEMBLA0A060D4H10.0A0A060D4H1_MAIZE; C2C2-DOF transcription factor (Fragment)
TrEMBLA0A317Y6100.0A0A317Y610_MAIZE; Dof zinc finger protein DOF5.3
STRINGGRMZM2G011832_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.18e-33TARGET OF MONOPTEROS 6