PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G010290_P01
Common NameZEAMMB73_612645, Zm.159898
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 420aa    MW: 42100.6 Da    PI: 8.5504
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G010290_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.7e-38105166263
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                        kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lr vPvGgg+rknk+sss
  GRMZM2G010290_P01 105 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRSVPVGGGSRKNKRSSS 166
                        7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-31101163IPR003851Zinc finger, Dof-type
PfamPF027018.4E-33107163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.742109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MAFLLSPRLT TPCIKRTTML SQGDVLQTCS AAAVLKHTAQ PYKSTSSKGV FCAVSLGLVK  60
PLEEMLMAAS AGAANPSQGS NPNPPPLAAP LTDAGSTERR ARPQKEKALN CPRCNSTNTK  120
FCYYNNYSLQ QPRYFCKTCR RYWTEGGSLR SVPVGGGSRK NKRSSSSSSS SSSSAAAASA  180
STSSSATSSS MASTPGAASK SPELAHEGAH DDLNLAFPHH GGLHAAEFAA FPSLESSNDM  240
CDQGGGMTSN GRGGGAGPAV GALSATELLR SSGCYMPLQM PGGDYTAAGF ALGEFRTPLL  300
PPPSSQSPLG FSLDAHGPGS SGAAAAAGYG SSAGLPQGVP GNAGRLLFPF EDLKPPVSPG  360
GGGVGGGGAS ATGGAGDGNS SHDQFDHNKE RGGGGGRGAG AGHDTPGFWS SMIGGSGASW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.859320.0ear| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G010290
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at low level in germinating seeds 3 to 5 days after imbibition. {ECO:0000269|PubMed:11470159}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G010290_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277650.0KJ727765.1 Zea mays clone pUT5711 C2C2-DOF transcription factor (DOF23) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001352097.10.0dof zinc finger protein
SwissprotQ9SXG81e-109DOF1_ORYSJ; Dof zinc finger protein 1
TrEMBLK7TVP90.0K7TVP9_MAIZE; C2C2-DOF transcription factor (Fragment)
STRINGGRMZM2G010290_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-37Dof family protein
Publications ? help Back to Top
  1. Washio K
    Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains.
    Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62
    [PMID:11470159]