PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G009530_P01
Common NameLOC100282764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GATA
Protein Properties Length: 281aa    MW: 31548.7 Da    PI: 8.7113
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G009530_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA35.71.2e-11130160131
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                        CsnC +++Tp WR gp+g  + C+aCG++ +
  GRMZM2G009530_P01 130 CSNCLSSQTPRWRDGPSGRQMMCSACGMRLK 160
                        ****************************987 PP

2GATA56.53.9e-18212246135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        C++C ++kTp+WR gp g+ktLCnaCG+++++ +l
  GRMZM2G009530_P01 212 CAHCLSSKTPQWRAGPLGPKTLCNACGVRFKSGRL 246
                        *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.477124160IPR000679Zinc finger, GATA-type
SMARTSM004012.0E-7124175IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.37E-9128161No hitNo description
Gene3DG3DSA:3.30.50.103.2E-11129161IPR013088Zinc finger, NHR/GATA-type
PfamPF003207.2E-10130160IPR000679Zinc finger, GATA-type
CDDcd002024.38E-7130160No hitNo description
PROSITE profilePS5011411.227206242IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-15206260IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.14E-13207270No hitNo description
Gene3DG3DSA:3.30.50.101.2E-13210244IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.81E-12211268No hitNo description
PfamPF003205.9E-16212246IPR000679Zinc finger, GATA-type
PROSITE patternPS003440212237IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MSFFASQESD ESNTEWLSGY VEDCFSSSTS YTNPVSAMAS EGVGKPKLPP PPSSNGRRKK  60
RSLASVMTNG DYQQFVLPLY VEPPLILIDQ KHWMAESELI HPKKDDDDRE VCQQQGQEQE  120
KGVPRLVKMC SNCLSSQTPR WRDGPSGRQM MCSACGMRLK PETRLSAEQQ CGQEEPTRKE  180
QEPDRKRKKA AKKTCYESSD APPSSDQQEK RCAHCLSSKT PQWRAGPLGP KTLCNACGVR  240
FKSGRLLPEY RPANSPTFVS CLHSNSHKKV MQMRQAVAQQ Q
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1184188RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.184980.0shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G009530
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G009530_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0652320.0BT065232.1 Zea mays full-length cDNA clone ZM_BFb0052B13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149142.10.0GATA zinc finger family protein
TrEMBLA0A096PVS70.0A0A096PVS7_MAIZE; Uncharacterized protein
STRINGGRMZM2G009530_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.24e-31GATA transcription factor 11