PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G006477_P01
Common NameGLK17, LOC100382084
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family G2-like
Protein Properties Length: 450aa    MW: 49645.6 Da    PI: 6.592
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G006477_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.58.1e-35231285155
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                        k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  GRMZM2G006477_P01 231 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQKYRT 285
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.969228288IPR017930Myb domain
SuperFamilySSF466892.87E-18229285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-32230287IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-26231285IPR006447Myb domain, plants
PfamPF002495.2E-10233284IPR001005SANT/Myb domain
PfamPF143792.6E-24314360IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MRNFNLMQSQ KSRVLGAMSS SLPILPNPLK GSFSRPHNPQ HIPMLRQLPD DSMPLCIDTH  60
QSASLHPRAG VIGVPYSGYT ASPLDSVSNL DSQTMAAPFI SQSSNFEALQ SLSNNTPETH  120
TKAAWFTSSM DVSPLNTDNI AASDVNQIQS IRPAMTSDES ATQNDWWADI MNDDWKDILD  180
ATATDSHSKA MIQISNSATS LPAVNQSASS HSREICPVAS PPNSSNASVA KQRMRWTPEL  240
HECFVDAVNQ LGGSEKATPK GVLKLMKVDG LTIYHVKSHL QKYRTARYKP DLSEGTSEKR  300
TATEELVLDL KTSMDLTEAL RLQMEVQKRL HEQLEIQRKL QLRIEEQGKY LQMMFEKQSQ  360
SSTEKVQDPS SRDTTAKPSS NQSQSTNKDC GATMDPNGTG GIVRTAELGE RSSELGVKQK  420
LVEIEESGTE VATGDRSKIS QEKRRKLQDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-30230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-30230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-30230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-30230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-30230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-30230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-30230289160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-30230289160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.235160.0endosperm| meristem| root| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G006477
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G006477_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0631020.0BT063102.1 Zea mays full-length cDNA clone ZM_BFc0026F11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001168318.10.0uncharacterized protein LOC100382084
RefseqXP_008643769.10.0putative MYB DNA-binding domain superfamily protein isoform X1
RefseqXP_008643772.10.0putative MYB DNA-binding domain superfamily protein isoform X1
RefseqXP_020393478.10.0putative MYB DNA-binding domain superfamily protein isoform X1
RefseqXP_020393489.10.0putative MYB DNA-binding domain superfamily protein isoform X1
SwissprotB8ANX91e-173PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLC0P4830.0C0P483_MAIZE; G2-like transcription factor
STRINGGRMZM2G006477_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.16e-70phosphate starvation response 1