PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G005353_P01
Common Nameyab14, ZEAMMB73_397307, Zm.98944
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family YABBY
Protein Properties Length: 268aa    MW: 28271.2 Da    PI: 7.2474
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G005353_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY183.21.5e-56242247170
              YABBY   7 seqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkee........................ 70 
                         eq+Cyv+C++C+tilav vP +slf++vtvrCGhC++ll vnl+       ++ aa +hl   ++                          
  GRMZM2G005353_P01  24 QEQICYVHCSYCDTILAVGVPCSSLFQTVTVRCGHCANLLYVNLRALLlppaTAPAAANHLPPFGQ-Allsptsphglldaetmssssfqap 114
                        79******************************************9988555445555566543332.1356678889655555555555444 PP

              YABBY  71 .......lleelkveeenlksnvekeesastsvssekl........................senedeevprvpp.virPPekrqrvPsayn 130
                                                      +   ++ +                          +e  ++pr    +++  ekrqrvPsayn
  GRMZM2G005353_P01 115 slpsaepP----------------------SAACVSGItsinntacggnnaasamapppakpALHEPPQLPRSAAsANKTSEKRQRVPSAYN 184
                        43332221......................22222222233444455555555556766555677777888876669*************** PP

              YABBY 131 rfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                        rfik+eiqrikasnPdi+hreafsaaaknWahfP+ihfgl
  GRMZM2G005353_P01 185 RFIKDEIQRIKASNPDITHREAFSAAAKNWAHFPHIHFGL 224
                        **************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.7E-6423224IPR006780YABBY protein
SuperFamilySSF470951.03E-7163218IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.0E-4173216IPR009071High mobility group box domain
CDDcd000848.31E-5178214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020126anatomytassel inflorescence
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MTSPVPETFS LQDQQPPPPP PAEQEQICYV HCSYCDTILA VGVPCSSLFQ TVTVRCGHCA  60
NLLYVNLRAL LLPPATAPAA ANHLPPFGQA LLSPTSPHGL LDAETMSSSS FQAPSLPSAE  120
PPSAACVSGI TSINNTACGG NNAASAMAPP PAKPALHEPP QLPRSAASAN KTSEKRQRVP  180
SAYNRFIKDE IQRIKASNPD ITHREAFSAA AKNWAHFPHI HFGLMPDQGL KKHPMQTQEG  240
AECMLFKDGL YAAAAAATAA SSMGISPF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.989440.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G005353
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G005353_P01
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3139010.0AY313901.1 Zea mays yabby14 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105230.10.0yabby14
SwissprotQ0JBF01e-110YAB5_ORYSJ; Protein YABBY 5
SwissprotQ01JG21e-110YAB5_ORYSI; Protein YABBY 5
TrEMBLQ7X9M90.0Q7X9M9_MAIZE; Uncharacterized protein
STRINGGRMZM2G005353_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144538121
Representative plantOGRP1734323
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.13e-40YABBY family protein
Publications ? help Back to Top
  1. Juarez MT,Twigg RW,Timmermans MC
    Specification of adaxial cell fate during maize leaf development.
    Development, 2004. 131(18): p. 4533-44
    [PMID:15342478]
  2. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]