PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G002075_P01
Common NameLOC100191233
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 295aa    MW: 32164.7 Da    PI: 10.0608
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G002075_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.53e-13216266555
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                        +r rr++kNRe+A rsR+RK+a++ eLe +v++L ++N++L  +  e+ ++
  GRMZM2G002075_P01 216 RRRRRMIKNRESAARSRARKQAYTMELEAEVQKLREQNQELERKQAEIMEM 266
                        689************************************998877777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.0E-14211275No hitNo description
SMARTSM003381.2E-11212277IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.22214265IPR004827Basic-leucine zipper domain
PfamPF001704.1E-11216266IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-10216265No hitNo description
PROSITE patternPS000360219234IPR004827Basic-leucine zipper domain
CDDcd147071.94E-19221267No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDELLRSIWT AEETQAKASA SIAGASAGMP PTPMQRQGSS LTLPRMLSTK TVDEAWRNLV  60
RDEPPQGADG GGHQPPHRQS TLGEMTLEEF LVRAGAVKEN PASAPPAPPP MVPPRPVPVA  120
PKSSAFFGDL PGADDDAATA AVGFAPVGMV DLALIPPRAA GMGGSAMAVQ TAVSQLDSVG  180
KGYSDLSSLT EPQTFSFERM IRGRRHGGGV EKVVERRRRR MIKNRESAAR SRARKQAYTM  240
ELEAEVQKLR EQNQELERKQ AEIMEMQNNE VSEMLKDPFG RKKRLCLRRT LTAPW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1195840.0meristem| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G002075
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves and embryos. {ECO:0000269|PubMed:10611387}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G002075_P01
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0332690.0BT033269.1 Zea mays full-length cDNA clone ZM_BFb0021I01 mRNA, complete cds.
GenBankEU9611690.0EU961169.1 Zea mays clone 233058 bZIP transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130139.10.0uncharacterized protein LOC100191233
SwissprotQ6ZDF33e-89TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLB4F8310.0B4F831_MAIZE; ABSCISIC ACID-INSENSITIVE 5-like protein 5
STRINGGRMZM2G002075_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.11e-21ABRE binding factor 4
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]
  4. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]