PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G001426_P01
Common NameLOC103650192, Zm.83039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family GRAS
Protein Properties Length: 475aa    MW: 50563 Da    PI: 5.7858
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G001426_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS408.28e-125764501374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                        lv+lL++cA av++ d++ a+a La  +    a +  + + R+a +ft AL++rl+  +++ + + pp + +    +++++ ++ f+e+ P+
  GRMZM2G001426_P01  76 LVHLLMSCAGAVEAADHAGASAHLADAHAAlaAVSPTSGIGRVAVHFTAALSRRLFPPTPSPSPSPPPPAPH-AADADRAFLYHRFYEAGPY 166
                        68***********************99988745555589******************777777655555554.67899999999******** PP

               GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                        lkf+h+taNqaIleav+g+++vHiiDf+i+qGlQWpaL+qaLa Rp+gppslR+Tg+g+p++  ++ l+ +g rLa++A++++v+f+f+ ++
  GRMZM2G001426_P01 167 LKFAHFTANQAILEAVQGCKHVHIIDFSIMQGLQWPALIQALALRPGGPPSLRLTGIGPPSPPGRDDLRDVGVRLADLARSVRVHFSFRGVA 258
                        ******************************************************************************************** PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsles...erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                        a+rl+++++++L+v++gEa+aVn+vlqlhrll++  s+ +   ++d+vL++v s++P+v++vveqeadhn++ Fl+rf+eal yysa+fdsl
  GRMZM2G001426_P01 259 ANRLDEVRPWMLQVSQGEAVAVNSVLQLHRLLADAPSSGDaraPIDAVLECVASVRPRVFTVVEQEADHNKPGFLDRFTEALFYYSAVFDSL 350
                        ********************************9988777766699*********************************************** PP

               GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                        +a       +     +++l+rei+++v+ ega rrerhe l +Wr+rl++ G+ +vpl+ +a  qa++l+  ++++g+ vee +g+l+lgW+
  GRMZM2G001426_P01 351 DAA---SGGAGDAAAEAYLEREICDIVCGEGAGRRERHEPLWRWRDRLGRTGLAAVPLGANALRQARMLVGLFSGEGHCVEEAEGCLTLGWH 439
                        998...235555666777************************************************************************** PP

               GRAS 364 drpLvsvSaWr 374
                        +rpL+s+SaWr
  GRMZM2G001426_P01 440 GRPLFSASAWR 450
                        **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.67350430IPR005202Transcription factor GRAS
PfamPF035142.8E-12276450IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006505anatomycentral spike of ear inflorescence
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0001007developmental stagepollen development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MAMGGAFPFQ WPEGPADPVL DDVTLPPLPT AAPDAGVAAY YADAADVHAM HMALPDFAAA  60
LAAMRREEEE AAGIRLVHLL MSCAGAVEAA DHAGASAHLA DAHAALAAVS PTSGIGRVAV  120
HFTAALSRRL FPPTPSPSPS PPPPAPHAAD ADRAFLYHRF YEAGPYLKFA HFTANQAILE  180
AVQGCKHVHI IDFSIMQGLQ WPALIQALAL RPGGPPSLRL TGIGPPSPPG RDDLRDVGVR  240
LADLARSVRV HFSFRGVAAN RLDEVRPWML QVSQGEAVAV NSVLQLHRLL ADAPSSGDAR  300
APIDAVLECV ASVRPRVFTV VEQEADHNKP GFLDRFTEAL FYYSAVFDSL DAASGGAGDA  360
AAEAYLEREI CDIVCGEGAG RRERHEPLWR WRDRLGRTGL AAVPLGANAL RQARMLVGLF  420
SGEGHCVEEA EGCLTLGWHG RPLFSASAWR AEENNQSDSR SRSSGSEESN ISCSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-56764504375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.830390.0ear| embryo| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G001426
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G001426_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9698160.0EU969816.1 Zea mays clone 336035 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001309202.10.0uncharacterized protein LOC103650192
SwissprotQ9LQT81e-126GAI_ARATH; DELLA protein GAI
TrEMBLA0A096PQB20.0A0A096PQB2_MAIZE; Uncharacterized protein
STRINGGRMZM2G001426_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-108GRAS family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]