PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G001048_P01
Common NameLOC100192062, ZEAMMB73_443682
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family B3
Protein Properties Length: 503aa    MW: 55394.6 Da    PI: 10.1268
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G001048_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3491.1e-15100194199
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                        ffkv+ p+ +++  rl++p  f ++ +++++++  ++l+ +sg++W+  l  +  s++   + +GWkeFv ++ L+ g f+vF++dg  +f 
  GRMZM2G001048_P01 100 FFKVFFPEQSTE--RLRIPPMFNQHLKEQQPTG-AVSLRGPSGNRWQAALASESESEAaWCFDQGWKEFVTDHSLRLGHFLVFTRDGPAQF- 187
                        889997766655..69******95555554444.8***************77555555799***********************7765555. PP

                        .EEEEE-S CS
                 B3  92 lvvkvfrk 99 
                          v vf++
  GRMZM2G001048_P01 188 -SVAVFSS 194
                        .8888875 PP

2B347.14.3e-15398488498
                        E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                 B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                        +++ s+v     + +  +f++e    +++sk++tl d+ g+ W+v + y + + +  +++GW +F+  n+L+  D++vF+l +  e +++v+
  GRMZM2G001048_P01 398 IMIESYVYVGFFMNIACEFVRESL--PRTSKKMTLWDPMGKPWDVSYVYYGDRAAGSFGGGWGRFALGNNLEKSDVCVFELFE--EDNMRVH 485
                        678899999999999999998884..46889******************888888889**********************865..5556888 PP

                        EE- CS
                 B3  96 vfr 98 
                        ++r
  GRMZM2G001048_P01 486 IYR 488
                        877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.5E-1997195IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.94398195IPR003340B3 DNA binding domain
CDDcd100178.35E-1698193No hitNo description
SuperFamilySSF1019362.94E-1698195IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.2E-13100195IPR003340B3 DNA binding domain
PfamPF023626.3E-13100193IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-22386488IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-22388488IPR015300DNA-binding pseudobarrel domain
CDDcd100176.79E-21393488No hitNo description
SMARTSM010195.3E-12395490IPR003340B3 DNA binding domain
PROSITE profilePS5086312.647395490IPR003340B3 DNA binding domain
PfamPF023621.0E-12398488IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 503 aa     Download sequence    Send to blast
MRGRKRQQVS ASSAAALVKG RESTKQKEKE ARKEKEAREA GREPAAKERQ MRRKAGKEKE  60
TETGGEGKEP AKEKEVREEG KENDKHKEKA KTKANVCPQF FKVFFPEQST ERLRIPPMFN  120
QHLKEQQPTG AVSLRGPSGN RWQAALASES ESEAAWCFDQ GWKEFVTDHS LRLGHFLVFT  180
RDGPAQFSVA VFSSSGVIDP AALDARPTAN GGAAVKLEDG EGVGVRGDVD AGGDTSSEVS  240
LLPAEEGDGG ATGRRTGATS GGAGGASEMS LVLREEGRGV TGKRARATTS DLPADASAPK  300
KHSALAKKAG KRRPQAATSK DVSMIVHNPT FSLLDESKTF NKTQIRDKNV PRSGKFLLRT  360
TKAPVVISQR RRVTEEEKCL ALRKAMEFKS KHPFTMQIMI ESYVYVGFFM NIACEFVRES  420
LPRTSKKMTL WDPMGKPWDV SYVYYGDRAA GSFGGGWGRF ALGNNLEKSD VCVFELFEED  480
NMRVHIYRVV PEITPLLRAS NKD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.1184530.0cell culture| ear| embryo| ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G001048
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G001048_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0614710.0BT061471.1 Zea mays full-length cDNA clone ZM_BFb0150H17 mRNA, complete cds.
GenBankBT0343560.0BT034356.1 Zea mays full-length cDNA clone ZM_BFc0007A03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130957.10.0uncharacterized protein LOC100192062
TrEMBLB4FB680.0B4FB68_MAIZE; Uncharacterized protein
TrEMBLK0D9L30.0K0D9L3_MAIZE; ABI36 ABI3VP1 type transcription factor (Fragment)
STRINGGRMZM2G001048_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.11e-13B3 family protein
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]