PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC233935.1_FGP005
Common NameLOC100501071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 387aa    MW: 40124.5 Da    PI: 10.218
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC233935.1_FGP005genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.34e-3989149262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        +e alkcprC+stntkfCyynnyslsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+nk+ss
  AC233935.1_FGP005  89 PEPALKCPRCESTNTKFCYYNNYSLSQPRHFCKTCRRYWTRGGSLRNVPVGGGCRRNKRSS 149
                        56789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3073138IPR003851Zinc finger, Dof-type
PfamPF027017.7E-3392147IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.62793147IPR003851Zinc finger, Dof-type
PROSITE patternPS01361095131IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MVFPSPSVQV YLDPHPPNWN NQQQQGQQPR ANGGADAPLL PLGPAAATSA APEQGGLPRS  60
SSMANAAVAA HARPNSMAER ARLARMPHPE PALKCPRCES TNTKFCYYNN YSLSQPRHFC  120
KTCRRYWTRG GSLRNVPVGG GCRRNKRSSK SSSSSAGSSS SKMSPSGRLL GGPSATPSTT  180
PGTTGAIITP GLSSFSHHLP FLGSMHPSGP NLGLAFSAGL PLVGMQHLDT VDQFPVASGG  240
GTTIGASLEQ WRVRQQQQQF PFMTGGILDL SQPPTYQFGL EANRGGSGSA AVAFNSGQTT  300
TTSATTGRQE GSSKKMGDSK GEDMSLQKQY MVPLRHGSGS HGVWDGSAGG TGSNGGGTGN  360
GGSSWPMNMI PGFHSSSTSG CNDSGLS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.282450.0tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC233935.1_FG005
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC233935.1_FGP005
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4284490.0JX428449.1 Zea mays subsp. mays clone pUT3043 DOF30 transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008646781.10.0uncharacterized protein LOC100501071 isoform X1
TrEMBLA0A1D6JY600.0A0A1D6JY60_MAIZE; DOF30 transcription factor
TrEMBLK0DCL50.0K0DCL5_MAIZE; DOF30 transcription factor (Fragment)
STRINGAC233935.1_FGP0050.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.25e-36OBF-binding protein 3