PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC233899.1_FGP004
Common NameLOC100282963, ZEAMMB73_726308
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 377aa    MW: 40640.4 Da    PI: 7.643
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC233899.1_FGP004genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.3e-18126179356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++ ++q+++Le++Fe ++ ++ +++++ A+ l L+ rqV vWFqNrRa++k
  AC233899.1_FGP004 126 KKRRLAPDQVRALERCFEADNRLDPDRKARVARDLALNPRQVAVWFQNRRARWK 179
                        455799***********************************************9 PP

2HD-ZIP_I/II115.63e-37125216192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl+ +qv++LE++Fe++++L+p+rK+++ar+L l+prqvavWFqnrRAR+k+k l +d++aL++++dal++++++L +e +eLr++l+
  AC233899.1_FGP004 125 EKKRRLAPDQVRALERCFEADNRLDPDRKARVARDLALNPRQVAVWFQNRRARWKAKALHRDFAALRARHDALRRDKDALAAEIRELRQKLA 216
                        69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.212121181IPR001356Homeobox domain
SMARTSM003898.0E-17124185IPR001356Homeobox domain
SuperFamilySSF466892.61E-16125180IPR009057Homeodomain-like
CDDcd000864.28E-14126179No hitNo description
PfamPF000461.8E-15126179IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.9E-18131179IPR009057Homeodomain-like
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
PfamPF021831.1E-7182215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MAAWVSCLHL WPLSLSLSLS LSTPSLTPVL QSCSARKEIG ITANSFVRAT RLLLFQDPCR  60
SLTIESPPFP NPFQSSAAKC RSQMKRQSKR PTASRDSPET GTVDKQLALA ESLTARKTEP  120
DELGEKKRRL APDQVRALER CFEADNRLDP DRKARVARDL ALNPRQVAVW FQNRRARWKA  180
KALHRDFAAL RARHDALRRD KDALAAEIRE LRQKLAEPAA VKTEATGSDT AEARPTTTTT  240
AGAPAPPAGG CKDGSSDSDS SVVLNDDVDA SPYSGAAFEQ PGAFAGFGAP FLAASAAAAP  300
PPTGCSSPPV FETKWQHGPT TYAFESYKSC CAGYGFTEEW LASSDVVGSD GAAGFFSEDH  360
ASSLNFSWCA SGAQDWE
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC233899.1_FG004
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC233899.1_FGP004
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9629680.0EU962968.1 Zea mays clone 246966 homeodomain-leucine zipper transcription factor TaHDZipI-1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001356198.10.0homeodomain-leucine zipper transcription factor TaHDZipI-1
SwissprotQ10QP32e-79HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A1D6PIK50.0A0A1D6PIK5_MAIZE; Putative homeobox DNA-binding and leucine zipper domain family protein
STRINGAC233899.1_FGP0040.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-22homeobox protein 16
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]