PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC233853.1_FGP002
Common NamebZIP117
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 288aa    MW: 31267.7 Da    PI: 6.6101
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC233853.1_FGP002genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.12.9e-11159204550
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                        kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  AC233853.1_FGP002 159 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVA 204
                        8999*********************************999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.6E-14155219IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76157213IPR004827Basic-leucine zipper domain
PfamPF001705.0E-10159209IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.48E-11159213No hitNo description
Gene3DG3DSA:1.20.5.1705.4E-14159213No hitNo description
CDDcd147033.89E-24160210No hitNo description
PROSITE patternPS000360162177IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MAQLPPKIPT VAPAWPEFGG GHQQQRSPSV GTFLAAAPMQ PSWVDEFLDF SAAKRGAHRR  60
SVSDSVAFLE PEPGPGDGNA GAHDFDRLDD DQLLSMFSDD LQPPPPQPQT QAAPAPVASS  120
SSPSDHNSIN DEKTDRGDAE EAQSKCHGAA ATATAVDPKR VKRILANRQS AQRSRVRKLQ  180
YISELERSVT SLQTEVSALS PRVAFLDHQR SLLTLGNSHL RQRIAALAQD KIFKDAHQEA  240
LRKEIERLRQ IYHQQSLKSG REPDAAPSVR DDKDMIGSEG TAAPGPPS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC233853.1_FG002
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots and panicles. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC233853.1_FGP002
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by dehydration and salt stress. {ECO:0000269|PubMed:18065552}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0612660.0BT061266.1 Zea mays full-length cDNA clone ZM_BFb0128B20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304169.10.0uncharacterized protein LOC100194309
SwissprotQ5QNI51e-100BZP02_ORYSJ; Basic leucine zipper 2
TrEMBLC0HG100.0C0HG10_MAIZE; BZIP transcription factor
STRINGAC233853.1_FGP0020.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-94bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]