PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC213524.3_FGP003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TCP
Protein Properties Length: 276aa    MW: 29555.2 Da    PI: 10.4612
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC213524.3_FGP003genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP57.65.4e-18137178243
                TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdk 43 
                        a+k+++++++hTkv+gR+RR+ ++a+caar+F+L++eL +  
  AC213524.3_FGP003 137 APKRSSNKDRHTKVDGRGRRIWMPALCAARIFQLTRELDHNG 178
                        789************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.9E-13142177IPR005333Transcription factor, TCP
PROSITE profilePS5136910.293143197IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MTVLHHSHLP TDTKAGAPVT KQKKGSESTK PDLVCFLLPR LGGSWCLCVS VCGDGPQVPP  60
PPPLNKTEPT TATTTTTSTA QQQQLDPKDY HQQQQPAQHL QIQIHQSPQQ DGGGRGKEEE  120
QLQVVAQPGE RRQQPLAPKR SSNKDRHTKV DGRGRRIWMP ALCAARIFQL TRELDHNGER  180
EDMERNRVRA WRLSSSVVAR TAAGAAGAGR GIAGGGMRPR ILPPARYGGG IGMEEESRDG  240
TGRPVFAAGM AAGGSWQTSG RTGLGSGGSL QSSLNS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC213524.3_FG003
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC213524.3_FGP003
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0433900.0BT043390.1 Zea mays full-length cDNA clone ZM_BFc0176F09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008650667.11e-170transcription factor TCP8
RefseqXP_008666499.11e-170transcription factor TCP8
TrEMBLA0A1D6KJT50.0A0A1D6KJT5_MAIZE; Transcription factor TCP11
STRINGAC213524.3_FGP0030.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.11e-19TCP family protein