PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC209819.3_FGP009
Common NameDOF44, ZEAMMB73_564100, Zm.131948
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 206aa    MW: 21595.6 Da    PI: 10.9046
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC209819.3_FGP009genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.41.1e-3667122560
             zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                         l+cprC s++tkfCy+nny+++qPr+fC+aC+ryWt+GGa+rnvP+G+grrkn+ 
  AC209819.3_FGP009  67 RLPCPRCLSRDTKFCYFNNYNVNQPRHFCRACHRYWTAGGAIRNVPIGSGRRKNRP 122
                        689**************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.6E-3068121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.12768122IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-2469121IPR003851Zinc finger, Dof-type
PROSITE patternPS01361070106IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MPVPGRAAAA CTGAAGIKLF GKVITTPPHH AGAAPPRLQQ AAAASGRGSA DLLEEVARAR  60
AAAAEVRLPC PRCLSRDTKF CYFNNYNVNQ PRHFCRACHR YWTAGGAIRN VPIGSGRRKN  120
RPVLLPPPAP HAVTATDNSR RSGAGSPPVF GSVFTAPYQQ LGAPTQFTTS PAYAATAPLG  180
TTGQCLWLVA TADHRSVASG RAFDLI
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC209819.3_FG009
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC209819.3_FGP009
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7270060.0KJ727006.1 Zea mays clone pUT3982 C2C2-DOF transcription factor (DOF44) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656439.11e-147cyclic dof factor 4
SwissprotO229671e-34CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A1D6FTB41e-146A0A1D6FTB4_MAIZE; Dof zinc finger protein DOF1.5
TrEMBLK7VH901e-146K7VH90_MAIZE; C2C2-DOF transcription factor (Fragment)
STRINGAC209819.3_FGP0091e-147(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.17e-30Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Bueso E, et al.
    Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration.
    Plant J., 2016. 87(6): p. 583-96
    [PMID:27227784]