PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC200057.4_FGP007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 379aa    MW: 40385.9 Da    PI: 6.7509
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC200057.4_FGP007genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.72.9e-092002501363
                        HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  13 NReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+     l++e+
  AC200057.4_FGP007 200 NRQSAARSKERKMRYISELERKVQTLQTEATTLSAQLTLLQRDTTGLTTEN 250
                        *************************************99998877777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-11190252IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.33E-10197244No hitNo description
CDDcd147037.08E-22197242No hitNo description
PfamPF001703.4E-7200249IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.2E-10200247No hitNo description
PROSITE profilePS502179.53200253IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MPGDGDPSDG LPPQSTRRAG APPSSSTPPR EYDISRMPDF PTRSTGHRRA HSEILGLPDD  60
LDLSAPGGGD GPSLSDENDE ELFSMFLDVD KLNSSCGASS EAEAESSSVA DGVGEGAELG  120
HAPRPRHQHS QSMDESMSIK AEQLVGAPGM EGMSSAEAKK AVSAAKLAEL ALVDPKRAKR  180
VVGGLSKTPP RSAPGWIWAN RQSAARSKER KMRYISELER KVQTLQTEAT TLSAQLTLLQ  240
RDTTGLTTEN SELKIRLQTM EQQVHLQDAL NDTLKAEVQR LKVATGQGPA NGGGGMMMNF  300
GAVPRAFGGG NQQTFHSSQS QAMQSMLATH QLQQLQLHSQ PQQQLQAQHL QQVARDLKMK  360
GHLGAQGQWG GGKSGSSGS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC200057.4_FG007
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC200057.4_FGP007
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9574120.0EU957412.1 Zea mays clone 1591211 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652949.10.0transcription factor RF2a
SwissprotQ69IL41e-143RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A1D6I8V30.0A0A1D6I8V3_MAIZE; Putative transcription factor PosF21
TrEMBLA0A3L6DZU60.0A0A3L6DZU6_MAIZE; Transcription factor RF2a
STRINGAC200057.4_FGP0070.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.17e-65bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]