PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC199782.5_FGP003
Common NameTCP19, Zm.31339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family TCP
Protein Properties Length: 343aa    MW: 35431.5 Da    PI: 4.9412
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC199782.5_FGP003genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP99.46.6e-3186167788
                TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                        r  ++hTkv+gR+RR+R+ a caar+  L++ LG+++d++ti WLlqq +p+i+++tgt++ +a + +  + +    ++ ++
  AC199782.5_FGP003  86 RYRDRHTKVEGRGRRIRMAAACAARVARLTRDLGHKSDGETIRWLLQQTEPSIIAATGTGTVPAIAITGTDGVLRLPAEPAS 167
                        678********************************************************88888444222222222211111 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136921.61287141IPR017887Transcription factor TCP subgroup
PfamPF036344.7E-2488151IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MKGTPNEGQS DLSMESQAPG RGEEGTKALY LAPEVIGNGT AAGAVAVDAM VSVEAGGSGL  60
PKPEPVPVEF LGSGGLQLSK PRPAPRYRDR HTKVEGRGRR IRMAAACAAR VARLTRDLGH  120
KSDGETIRWL LQQTEPSIIA ATGTGTVPAI AITGTDGVLR LPAEPASEDA SGEQQEPAPK  180
RRRKLQPTRA AVGPAVPAPA AYYPVVADPR LQANGGGAIS VSSGLAPASA PAAPAGAIPF  240
IAIAAPRPSA AGDGKQMIPP AAMWMVPQQA GAGNQPTHYW AFTTNSEFLS YQQQSVFQQQ  300
VVYDGEQLVG DGESQGQQTG GYQHGDGEGV DEEIAVTDSS SEE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1178184PKRRRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.313390.0ovary
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC199782.5_FG003
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings and leaves, mostly in the lower region rich in dividing cells. {ECO:0000269|PubMed:9338963}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC199782.5_FGP003
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7268270.0KJ726827.1 Zea mays clone pUT3366 TCP transcription factor (TCP19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001131265.20.0uncharacterized protein LOC100192578
SwissprotA2YXQ18e-74PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH68e-74PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A060D3Z80.0A0A060D3Z8_MAIZE; TCP transcription factor (Fragment)
STRINGAC199782.5_FGP0030.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Representative plantOGRP31781129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.21e-21TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]