PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC193786.3_FGP005
Common NameZEAMMB73_246253
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bHLH
Protein Properties Length: 247aa    MW: 26905.2 Da    PI: 7.631
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC193786.3_FGP005genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH46.37.6e-1572124155
                        CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                        r+ +hn+ Er RR+++N+ ++ Lr+llP a   + kKls  +++ ++ +YI +Lq
  AC193786.3_FGP005  72 RKLSHNAYERGRRKQLNELYSSLRSLLPDA--DQTKKLSIPTTVSRVLKYIPELQ 124
                        6889*************************6..48888***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.79E-1669139IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088814.48871123IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.34E-1171127No hitNo description
PfamPF000105.9E-1272124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.2E-1272139IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003533.7E-1077129IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MDHQLFDDPF GSSISSLEAE IFSAAAQLPP SPPWPDIDLD DDYDIHDLSA PAANAATSSG  60
GGYGSGGSGG HRKLSHNAYE RGRRKQLNEL YSSLRSLLPD ADQTKKLSIP TTVSRVLKYI  120
PELQKQVDNL ERRKKELTNA NCKPGVLKTT KAVTPIVSAT CLNDTEIMVQ VSLHSDVAAT  180
ALPLSKCIKV LENEGLHLVS SSTYSSAFEN KTFYSLHLQF QAPNPQARGV TGSLSISRIR  240
ERPQQTK
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC193786.3_FG005
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC193786.3_FGP005
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7280050.0KJ728005.1 Zea mays clone pUT6138 bHLH transcription factor (bHLH126) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656862.11e-161PREDICTED: transcription factor ORG3-like
TrEMBLK7W1D90.0K7W1D9_MAIZE; Putative HLH DNA-binding domain superfamily protein
STRINGAC193786.3_FGP0050.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28261129
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.13e-30bHLH family protein