PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC190609.3_FGP001
Common NameZEAMMB73_534640, Zm.33443
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 404aa    MW: 42870.9 Da    PI: 4.9328
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC190609.3_FGP001genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.76e-09215273563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        k+++r + NR +A rs +RK  +i+eLe+kv+ ++ e +aL+ +l  l+   a l+ e+
  AC190609.3_FGP001 215 KKAKRIINNRQSAARSKERKMRYIAELERKVQFMQREATALATQLALLQRDTAGLTVEN 273
                        89********************************************9999988887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-14211275IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.208213276IPR004827Basic-leucine zipper domain
PfamPF077161.8E-7213264IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.4E-10215267No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-9215269No hitNo description
CDDcd147037.19E-23216267No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MKSIDILSLQ CVSFEILAGN NMNMDKTPIA GDGGGDAGGG GGGSGNGPEM QSSLDAVAPS  60
PTPHTELDIS SMPDTPLRKP GHRRALSEII GLPDDLDLGG PGAGDAPALS DENEEELFSM  120
FLDVDKLNSR CGASESEPSC AMAGGPGEAT ETSAAASGAA QGQMHHHNRH SMDASSSIDA  180
EHLFGTTVTE GVSPAEAKKA MSAANLAELA LIDPKKAKRI INNRQSAARS KERKMRYIAE  240
LERKVQFMQR EATALATQLA LLQRDTAGLT VENGDLKIRL ESTEQQIHLQ DALNGALKSE  300
MQRLKMATGQ AGNQMMNFAE PPHTFGGANQ QVFHHPGQAV PPFLVAMQQQ QQLLLPHMNQ  360
PLHPLQSQQL HQAATLSIDM EGLPAAPPGQ WQWGGDTWSE SSSS
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC190609.3_FG001
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at high levels in levels in leaf sheath, moderate levels in leaf blade, but not in roots. Predominantly expressed in vascular tissues. {ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC190609.3_FGP001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9692720.0EU969272.1 Zea mays clone 327824 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008679479.10.0transcription factor RF2a
SwissprotQ69IL41e-101RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A1D6QJ260.0A0A1D6QJ26_MAIZE; Putative bZIP transcription factor superfamily protein
STRINGAC190609.3_FGP0010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Representative plantOGRP12617181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31370.58e-60bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]