PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC186606.4_FGP003
Common NamebZIP126, LOC100286290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family bZIP
Protein Properties Length: 202aa    MW: 22494.2 Da    PI: 7.0028
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC186606.4_FGP003genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.32.5e-11107160457
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         +r rr+ +NRe+ArrsR RK+ ++ eL   v  L + N++L + l++    +a
  AC186606.4_FGP003 107 ERRRRRMVSNRESARRSRMRKQRQLSELWAQVSHLRGANRRLLDDLNRALRSCA 160
                        5899***************************************99998777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.9E-9103159No hitNo description
SMARTSM003387.2E-10104168IPR004827Basic-leucine zipper domain
PfamPF001708.6E-9106158IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.243106169IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.86E-10108156No hitNo description
PROSITE patternPS000360111126IPR004827Basic-leucine zipper domain
CDDcd147021.44E-14113160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MYHHHFHGEV ASLRFLSPPN VSTSFAAHHH MNMALPPPSY FQDDDATLAA IDGGDAACFD  60
ELDTIVVVPE ADAAAAARCH LTGSNNGGLS DSDQLLDAAV IMAADEERRR RRMVSNRESA  120
RRSRMRKQRQ LSELWAQVSH LRGANRRLLD DLNRALRSCA DARRESARLR EEKAELTKKL  180
EQLLQAEKGS LSEAAEPCKS YC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120127RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.498000.0shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC186606.4_FG003
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC186606.4_FGP003
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9766320.0EU976632.1 Zea mays clone 985663 bZIP protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152649.11e-147uncharacterized protein LOC100286290
TrEMBLB6UHB71e-145B6UHB7_MAIZE; BZIP protein
STRINGAC186606.4_FGP0031e-146(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Representative plantOGRP1302545
Publications ? help Back to Top
  1. Alexandrov NN, et al.
    Insights into corn genes derived from large-scale cDNA sequencing.
    Plant Mol. Biol., 2009. 69(1-2): p. 179-94
    [PMID:18937034]