PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AC155434.2_FGP006
Common NameZm.17445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Dof
Protein Properties Length: 478aa    MW: 49984.8 Da    PI: 8.1057
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AC155434.2_FGP006genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-3968128262
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rn+PvG+grrk+k+ss
  AC155434.2_FGP006  68 PDKILPCPRCNSMDTKFCYYNNYNIKQPRHFCKSCQRYWTAGGSMRNIPVGAGRRKSKSSS 128
                        7899*****************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-2665117IPR003851Zinc finger, Dof-type
PfamPF027013.3E-3270126IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.50972126IPR003851Zinc finger, Dof-type
PROSITE patternPS01361074110IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MSVTGEKPCT HRESDVGQTN SCSLNNSSEC ENHTPSNDEI SEPESNLEMA KTDQGGDVPS  60
GEKVLKKPDK ILPCPRCNSM DTKFCYYNNY NIKQPRHFCK SCQRYWTAGG SMRNIPVGAG  120
RRKSKSSSAS CRSVLIPVPG SSSVANPGGE ASLFPLSVKA NQAAVSFGPD SPLCTSMASV  180
LKIGGGGEQV KSCSPASAAA QPRNGETQTQ TCAPSSAATT PSDGPGNGLQ KGAESAHQNQ  240
NQNQNGIIGH SNGVTPVHPI PFFPGPPFVY PWSPAWNGIP AMAAAVCAAP ATAEAAISSE  300
HGTASSTVQW NVPPAIVPVL PPGFCGPIPV PVIPPPSVWP LITPWPNAAW SAPWLGPSAS  360
VPPGSSRSSG SSTCSDSGCG SGSPVLGKHS RESRPQGDEK AERRCLWIPK TLRIDDPVEA  420
AKSSIWTTLG IEPGDRGMFR PFQSKHGRQQ ELQASGAARA LQANPAALSR SQSFQETT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.174450.0aerial organ| meristem| ovary| shoot| tassel
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAC155434.2_FG006
Cis-element ? help Back to Top
SourceLink
PlantRegMapAC155434.2_FGP006
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0645830.0BT064583.1 Zea mays full-length cDNA clone ZM_BFc0185L15 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001143564.10.0uncharacterized protein LOC100276261
TrEMBLC0P8G40.0C0P8G4_MAIZE; Uncharacterized protein
STRINGAC155434.2_FGP0060.0(Zea mays)
STRINGGRMZM6G787651_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.28e-35cycling DOF factor 2