PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015902753.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 205aa    MW: 23191.8 Da    PI: 8.5632
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015902753.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601301e-40101091100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+C+k+C+lapyfpae++k+f+n+h+lFG++n++++lk++p++++edam+s+++e+++ra+ Pv+G++g+i++l+ ql+q+ +el 
  XP_015902753.1  10 ACAACKYQRRRCSKECALAPYFPAEKAKEFQNAHRLFGVRNIMNILKQVPPQHKEDAMTSIIFESDMRAQYPVRGCMGIISQLHLQLQQSIEELR 104
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l++++
  XP_015902753.1 105 LVQTK 109
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.8689110IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-3810107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MTIKGGTSQA CAACKYQRRR CSKECALAPY FPAEKAKEFQ NAHRLFGVRN IMNILKQVPP  60
QHKEDAMTSI IFESDMRAQY PVRGCMGIIS QLHLQLQQSI EELRLVQTKL AICKEQCQYQ  120
IPLSPSNFLP QLHLGMNSKN DALPIHHHPQ YNCVGGEMAI EFLGNNGIAT TTSMTNTIMN  180
GIYIEAEDNN MVKPLRNQSP YYSRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902753.11e-154PREDICTED: LOB domain-containing protein 27-like
SwissprotQ9STS62e-39LBD27_ARATH; LOB domain-containing protein 27
TrEMBLM5WV191e-72M5WV19_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-36LOB domain-containing protein 27