PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015902669.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family B3
Protein Properties Length: 440aa    MW: 51144.7 Da    PI: 9.1783
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015902669.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.73.8e-17694294
                    EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3  2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
                    f +l+ s++ ++++l++p +f++++  +   s+  tl+ ++g +W+v l  ++ +++y++ +GW +Fv+   +++g f+vF+++g+s+f+ ++
  XP_015902669.1  6 FHKLVLSSTIQTKQLRIPESFVKKFRDE--LSTIATLNVPDGHVWRVGL--KRVDNKYWFHDGWHGFVERYAIRVGYFLVFRYEGNSTFSVFI 94
                    45677789999999********999755..888999*************..**********************************99996655 PP

2B359.65.6e-19302392498
                     E-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     vl ps+  + ++++lp  fae++ +g++     ++l++++gr+W+v++ yr+++    l++GW eF  +n+L egD++vF+l + ++  l+v+vf
  XP_015902669.1 302 VLRPSYLYRGCIMYLPSCFAEKNlNGVSG---FIKLQTSDGRQWSVRCLYRGGR--AKLSQGWYEFSLENHLGEGDVCVFELLKMRDIVLKVTVF 391
                     78899******************877743...5***************665555..66***********************99888888999998 PP

                     - CS
              B3  98 r 98 
                     r
  XP_015902669.1 392 R 392
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.9E-23398IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.1E-24397IPR015300DNA-binding pseudobarrel domain
CDDcd100178.27E-18496No hitNo description
PROSITE profilePS5086313.831598IPR003340B3 DNA binding domain
SMARTSM010191.1E-156100IPR003340B3 DNA binding domain
PfamPF023628.8E-15694IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.3E-24291392IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-24292392IPR015300DNA-binding pseudobarrel domain
CDDcd100173.23E-22297392No hitNo description
SMARTSM010193.1E-18299394IPR003340B3 DNA binding domain
PROSITE profilePS5086314.043299394IPR003340B3 DNA binding domain
PfamPF023624.1E-17302392IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MPRPYFHKLV LSSTIQTKQL RIPESFVKKF RDELSTIATL NVPDGHVWRV GLKRVDNKYW  60
FHDGWHGFVE RYAIRVGYFL VFRYEGNSTF SVFIYNLNTS EINYQSNALS SPEAVYRNRY  120
QVFEEMEDED NVEILGSYVP SGSLKHKLFA DCSDHLTQGK GFNPPSLQNL FNGSKQKNCI  180
SWGNEGNMHP GKVAGSLQAG NQSTRDIGVQ FNVMELKRSV DEVKFHNSEA NIQKIKKSIR  240
KKRKMDADDE ESSVPHEEDV EMRFRFYESA SARKRTVTAE ERERAINAAK AFEPANPFCR  300
VVLRPSYLYR GCIMYLPSCF AEKNLNGVSG FIKLQTSDGR QWSVRCLYRG GRAKLSQGWY  360
EFSLENHLGE GDVCVFELLK MRDIVLKVTV FRVAEEAGYM NQHQHQHQHH HHHHHQHHHH  420
HPHTHPHQQH TVSHIKLIRN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A7e-7326539515144B3 domain-containing transcription factor VRN1
4i1k_B7e-7326539515144B3 domain-containing transcription factor VRN1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the regulation of vernalization. Acts as transcriptional repressor of FLC, a major target of the vernalization pathway. Binds DNA in vitro in a non-sequence-specific manner. {ECO:0000269|PubMed:12114624}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015902669.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1899192e-79KF189919.1 Frangula alnus subsp. alnus clone Contig4847 polymorphic genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902669.10.0B3 domain-containing transcription factor VRN1-like
SwissprotQ8L3W11e-141VRN1_ARATH; B3 domain-containing transcription factor VRN1
TrEMBLA0A2P5BW720.0A0A2P5BW72_TREOI; B3 DNA binding domain containing protein
STRINGXP_010096266.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-135B3 family protein
Publications ? help Back to Top
  1. Mantegazza O, et al.
    Analysis of the arabidopsis REM gene family predicts functions during flower development.
    Ann. Bot., 2014. 114(7): p. 1507-15
    [PMID:25002525]
  2. Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS
    Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana.
    Plant Cell Rep., 2018. 37(6): p. 901-912
    [PMID:29541883]