PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015902627.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family WRKY
Protein Properties Length: 500aa    MW: 55070.9 Da    PI: 6.7565
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015902627.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.97.6e-32135192260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d++++ei+Y+g+H+h+k
  XP_015902627.1 135 EDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITEIIYKGTHDHPK 192
                     7****************************************.***************85 PP

2WRKY106.51.4e-33310368159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  XP_015902627.1 310 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 368
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.26E-24133193IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-26133193IPR003657WRKY domain
SMARTSM007747.5E-34134192IPR003657WRKY domain
PROSITE profilePS5081122.446135193IPR003657WRKY domain
PfamPF031062.0E-24135191IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-37295370IPR003657WRKY domain
SuperFamilySSF1182901.83E-29302370IPR003657WRKY domain
PROSITE profilePS5081138.825305370IPR003657WRKY domain
SMARTSM007743.1E-39310369IPR003657WRKY domain
PfamPF031062.8E-26311368IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MAHGFLGSTT YSAVSVCSDL SDSSKRDSSC FEFRPHARSN MVTTDPYNQR SEQSVQVQGQ  60
CQSQSLVSLP MVKSEMAVTS SELSLSAPVN IVASGASAPA ESDLDELNQR GNLNSGVQTA  120
QFDHKGNGPS PVTSEDGYNW RKYGQKHVKG SEFPRSYYKC THPNCEVKKL FERSHDGQIT  180
EIIYKGTHDH PKPQPSRRYN TGTIMSSQEE RSDKFSSLTG RDDKSSSLYG QMTNTNEPNG  240
TPDVSPIAAI DDVVEGTGLL SNRINDEGDD DDPFSKRRKM DIGGIDVTPV VKPIREPRVV  300
VQTLSEVDIL DDGYRWRKYG QKVVRGNPNP RSYYKCTNAG CPVRKHVERA SHDPKAVITT  360
YEGKHNHDVP TARTSSHDTA GPMTVSVPTR IRSEETDNIS LDLGVGITCA AENRPTDHLQ  420
TVHSELVESQ SQNSNLKLVQ ANPVSSYYGV LNSGLNQYGS RENMSEGHSI EIPALNRSSY  480
PYPQNMGRVL TVVHPKAVLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-37135370877Probable WRKY transcription factor 4
2lex_A4e-37135370877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902623.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM5X2W20.0M5X2W2_PRUPE; Uncharacterized protein
STRINGVIT_19s0090g01720.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-175WRKY family protein