PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015901276.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 181aa    MW: 20374.9 Da    PI: 8.2973
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015901276.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26033.21.4e-101524596
          DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
                    ++k+++ee+r++a++slv+eA++r++dPv G ++ ++k+ ++l+  k+e ++
  XP_015901276.1  1 MVKNIREEDRRRAVDSLVWEACCRQKDPVLGPYSEYKKVYEELKMYKSEENQ 52
                    689999**************************************99988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.985157IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-8151IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MVKNIREEDR RRAVDSLVWE ACCRQKDPVL GPYSEYKKVY EELKMYKSEE NQMLQLTGQK  60
NTISYKSLSS LVARNNGGHG ISSNGTGVGG VVSSNGFNYF HESGNVLVEP STFGYPSNYM  120
QLCSEKTRGE KNIDSVVPLQ QHLVSGGFNQ QYYHSGNLVC YYLMNHTILL SHFLASNIKS  180
L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881257.11e-133PREDICTED: LOB domain-containing protein 2-like
RefseqXP_015901276.11e-133PREDICTED: LOB domain-containing protein 2-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127222534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.16e-17LOB domain-containing protein 2