PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015900006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family CAMTA
Protein Properties Length: 894aa    MW: 100860 Da    PI: 7.4266
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015900006.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1168.97.8e-5331183118
            CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrr 97 
                     + ++rwl+++ei+aiL n++++++  ++ + pksg++iL++rk++r+frkDG++wkkkkdgktv+E+he+LKvg  e +++yYah+++nptf rr
  XP_015900006.1   3 EARSRWLRPNEIHAILCNYKRFTINVKPVNLPKSGTIILFDRKMLRNFRKDGHNWKKKKDGKTVKEAHEHLKVGDEERIHVYYAHGQDNPTFVRR 97 
                     459******************************************************************************************** PP

            CG-1  98 cywlLeeelekivlvhylevk 118
                     cywlL+++le+ivlvhy+e++
  XP_015900006.1  98 CYWLLDKSLEHIVLVHYRETQ 118
                     ******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143778.2991123IPR005559CG-1 DNA-binding domain
SMARTSM010761.2E-771118IPR005559CG-1 DNA-binding domain
PfamPF038592.1E-463116IPR005559CG-1 DNA-binding domain
SuperFamilySSF812963.29E-15345432IPR014756Immunoglobulin E-set
PfamPF018333.9E-4346431IPR002909IPT domain
SuperFamilySSF484033.11E-18531643IPR020683Ankyrin repeat-containing domain
PfamPF127961.4E-8532610IPR020683Ankyrin repeat-containing domain
CDDcd002041.25E-15532640No hitNo description
Gene3DG3DSA:1.25.40.206.9E-18534644IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029717.237539652IPR020683Ankyrin repeat-containing domain
SMARTSM002484.3E-6581610IPR002110Ankyrin repeat
PROSITE profilePS5008811.915581613IPR002110Ankyrin repeat
SuperFamilySSF525405.84E-7692795IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001533725747IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.327729755IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.272745774IPR000048IQ motif, EF-hand binding site
SMARTSM00015270748766IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0011767789IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.768768792IPR000048IQ motif, EF-hand binding site
PfamPF006124.1E-4769789IPR000048IQ motif, EF-hand binding site
SMARTSM0001510847869IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.279849877IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 894 aa     Download sequence    Send to blast
MEEARSRWLR PNEIHAILCN YKRFTINVKP VNLPKSGTII LFDRKMLRNF RKDGHNWKKK  60
KDGKTVKEAH EHLKVGDEER IHVYYAHGQD NPTFVRRCYW LLDKSLEHIV LVHYRETQEL  120
QGSPVTPVNS NSSSASDPSA PWPLSEELDS GTNHAYYAGE NEILVSSDNL TVRNHEQRLH  180
DINTLEWDEL LAIHDPNNSV ASRDKVSFFN QQNQVAGNGL LHGGATSLSP EILSFNILTN  240
PTATSGDIGY NLPQSAYVPT VGAQLNSNVQ RRDSIGAGAG GSLDVLVNDG LHSQDSFGRW  300
INDFITDSSD SVDGSVLETS IPSAQDSFSS LAMHLQSPVS EQIFNITDVS PAWAYSNEKT  360
KILLTGFFRE EYQHLSKSDL LCVCGDISVT AEIVQVGVYR CLVSPHSPGL VNLYISLEGF  420
KPISQVLNFE YRTPALSDQI VSSEERDRWE EFQMQMRLAY LLFSTSKSLE ILTSKASPNA  480
LKEAKKYAQK TSHVSNSWAI FIKSIEDSKI PFSQAKDSLF KLILRNRLKD WLLERVVYGS  540
KISEFDAQGQ GVIHLCAILG YTWAISLFSA SGLSLDFRDK HGWTALHWAA YFGREKMVAV  600
LLSAGAKPNL VTDPTSDNPG GRTAADLASL NGYDGLAGYL SEKALVEQFK DMSIAGNVSG  660
TLDTSTNDFV NPENLCEEEL NLKETLAAYR TAADAAARIQ VAFREHSLKI RTQAVENSNP  720
EIEARNIVAA MKIQHAFRNY ESRKKMAAAA RIQHRFRTWK IRKEFLNLRR QAIKIQAAFR  780
GYQVRRQYRK ILWSVGVLEK AILRWRLKRR GFRGLQVDPI EAVDDQFQGS DTEEDFYKAS  840
KKQAEERVER AVVSVQAMFR SKKAQEEYRR MKMAHNQAML EYEGFLDPEN DLVG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00435DAPTransfer from AT4G16150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015900006.10.0PREDICTED: calmodulin-binding transcription activator 5 isoform X1
SwissprotO234630.0CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLK7L3K80.0K7L3K8_SOYBN; Uncharacterized protein
STRINGGLYMA07G37090.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42883459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.10.0calmodulin binding;transcription regulators