PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015896959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family WRKY
Protein Properties Length: 251aa    MW: 28026.8 Da    PI: 4.3679
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015896959.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY55.61.1e-17831202158
                     -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY  21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     +rsYYrCt ++C++kk+vers++dp++++itYeg H h
  XP_015896959.1  83 ARSYYRCTNPRCSAKKQVERSSDDPETFIITYEGLHLH 120
                     6***********************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007741.8E-881122IPR003657WRKY domain
PfamPF031069.2E-1383120IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.5E-1583120IPR003657WRKY domain
SuperFamilySSF1182901.83E-1383120IPR003657WRKY domain
PROSITE profilePS5081115.57184123IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEETIGSWSN GSEEELVREL LDDESPLFVL QEEATEFKNS PPNEEALLNR FNPQVYSGPT  60
IDDIENALSV TTRRIQSDEL SPARSYYRCT NPRCSAKKQV ERSSDDPETF IITYEGLHLH  120
FAYPFFFVGQ PQLGNPPIKK TKKNISGPEA QNHEPTQTLE AHESLSDVNP EMGPGSVMDH  180
HNHREVGEEE RSSQGLIQDV VPLMILNPSS NTSSNSSCSS YRSPPTSPSS LSWPLNFSTS  240
YFDVGINSSI M
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896959.10.0PREDICTED: probable WRKY transcription factor 49
TrEMBLV7B7R44e-65V7B7R4_PHAVU; Uncharacterized protein
STRINGGLYMA07G16040.24e-63(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71183449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.11e-22WRKY DNA-binding protein 49