PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015896060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Nin-like
Protein Properties Length: 1009aa    MW: 110927 Da    PI: 5.0552
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015896060.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.7e-29591641252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  XP_015896060.1 591 EKSISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGIPRWPSRKINKV 641
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.087580661IPR003035RWP-RK domain
PfamPF020424.4E-26594641IPR003035RWP-RK domain
SuperFamilySSF542771.18E-239061001No hitNo description
SMARTSM006663.0E-26915997IPR000270PB1 domain
PROSITE profilePS5174523.573915997IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2408.8E-26915996No hitNo description
CDDcd064074.63E-36916996No hitNo description
PfamPF005644.9E-19916996IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1009 aa     Download sequence    Send to blast
MSESEEETPS FPPKSKDVVD DVREAALMDF DLEIASPWPL DQIAFVSNPM SPLTFSSTEQ  60
PYSPLWAFCD GDNDEKLAGN VNSPIADCPR MISCDSNSVT ETPAEKMNED KRVWISPLLG  120
PAPIENLDGY CLIKEKMNQA LRYLKDSTDQ HILAQVWAPV KNGCQYVLAT SGQPFVLDPH  180
SNGLHQYRMV SLMYMFSVDG DSEGALGLPG RVFRQKLPEW TPNVQYYSIR EYPRLGHAQH  240
YNVQGTLAVP VFEPSGQACV GVLELIMTSP KINYAPEVDK VCKALEAVNL KSSEILDHTG  300
TQICNEGRQN ALTEILEILT VVCETHKLPM AQTWVPCMHR NVLTYGGGLK KSCTSFDGSC  360
MGQVCMSITD VAFYIIDSSM WRFREACLEH HLQKGQGVAG RAFLTHNLCF CADITQFCKI  420
EYPLVHYARM FGLTSCFAIC LRSTHTGDDD YILEFFLPPS ISDSSQQQIF LGSLLATMKK  480
HFQSLRVASG VGFDEEVFVE IIQASSSEGL DSRLECIQVS QSPESSPGPN ILSNVGDIVQ  540
PDSSPHQLIE DFCAANDRST AAQDGRSHSH VSLRESKDTK KTSERKRGKT EKSISLEVLQ  600
QYFAGSLKDA AKSLGVCPTT MKRICRQHGI PRWPSRKINK VNRSLSKLKR VIESVQGAEG  660
AFGLTPLSSS PLPVSVASVS QPFMLNGTNS PSPKACEPLT EKKKQQTSFS LGREGLAGME  720
EPLLGGVLRP EELIHENIRF LPEIGRGLNQ SKSGSSSREA SAGTPTSHGS CQGSPANGSA  780
AEKDYLASCQ DSPANGTTII KDPISSIHEQ CVKVDVSPES ALQPTDELLK FPVACSIDAL  840
VTTESQEPFG RMLIEDAGSS KDLRNLCPTA DAILDEQVPE FCWVNPQCLD LATKLPMGTL  900
APTTSHLKPR QEMKSVTIKA TYREDIIRFR ITLGSGIVEL KEEVAKRLKL EVGTFDIKYM  960
DDDHEWVLIA CDADLQECMD ICISSGSNMI RLLVHDIMPN LGSSCESTE
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015896060.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015896060.10.0protein NLP7 isoform X1
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLW9SKU20.0W9SKU2_9ROSA; Protein NLP7
STRINGXP_010107269.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]