PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015895206.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family SBP
Protein Properties Length: 514aa    MW: 57356.1 Da    PI: 7.6511
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015895206.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.63.2e-42172247277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv+gC++dls+ k+yh+rhkvC+vhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  XP_015895206.1 172 CQVHGCNMDLSSSKDYHKRHKVCDVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRRRLAGHNERRRKPQ 247
                     **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.1E-34167233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.906169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-40170251IPR004333Transcription factor, SBP-box
PfamPF031106.6E-32172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MESWNLASEG KSLLFSDELD WSDAFPRSRK ALIQCDNGLV SSRESVESME LMELGFSDMI  60
RRPFHGSQGL EILCGDQVGN CSSSRVSSPT CLITSNSSFG EEESGSKLSS PFMESISQDS  120
SLIDLKLGRF VDCKSSQNHE HSKEKPNLSS VRPSLLAKRS RTRGSYPQTP FCQVHGCNMD  180
LSSSKDYHKR HKVCDVHSKT AKVIVNGIEQ RFCQQCSRFH LLAEFDDGKR SCRRRLAGHN  240
ERRRKPQLDS LSDKSHKLFQ SYQGTRYLGT LPKRTPYVFP DILPGAIRYP GKYGQANQYG  300
NVRLEDEPLY SPQFALPTTS RQLHSKSFIH LHDIGKHHAS GISTSRTEDY DFDTASTVQK  360
SSVSGTSNST CALSLLSAQS QNLSCHSAEI PTASPLIQGA HHGISQLTDK PLRLRSTERY  420
GANGFYSCGM NSMGVNQLES IVLPEASQAV DFQVHADRAF QESDCLDAKY CLSPEHGSTV  480
DLLQLSSHLQ RVERQRNFAQ IKQENEEFCC FPTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291712451084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015895206.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895206.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A2P5FHG10.0A0A2P5FHG1_TREOI; SBP-box transcription factor
STRINGXP_010091609.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-51SBP family protein