PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015893988.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HB-PHD
Protein Properties Length: 673aa    MW: 76964.9 Da    PI: 9.354
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015893988.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox361.2e-11451495953
                     HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     ++ +e+L e+F++n  ps++ +e L+k+lgL+ ++V+ WF+N R+
  XP_015893988.1 451 HNAVERLREVFAENELPSRAVKENLSKELGLDPEKVSKWFKNARY 495
                     67899**************************************97 PP

2PHD40.56.1e-14209264151
                     SBTTTSSTCT..TSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
             PHD   1 rCkvCgksde..egelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                     +C+ C+  d+  +++++lCd +C+++fH+kCl+++l++e++p g   w+C+ C++k
  XP_015893988.1 209 FCAKCKLRDAfpDNDIILCDgTCNSAFHQKCLDPPLDTENIPPGdqGWFCRFCDCK 264
                     699999944455********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579032.66E-14201266IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.9E-12205264IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.416207264IPR019787Zinc finger, PHD-finger
CDDcd155041.14E-29209261No hitNo description
SMARTSM002494.1E-9209262IPR001965Zinc finger, PHD-type
PfamPF006282.4E-11209264IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590210261IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.609.5E-13437494IPR009057Homeodomain-like
PROSITE profilePS5007112.471440500IPR001356Homeobox domain
SMARTSM003893.0E-10442504IPR001356Homeobox domain
SuperFamilySSF466892.27E-10443504IPR009057Homeodomain-like
CDDcd000863.35E-9443495No hitNo description
PfamPF000463.4E-9451495IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 673 aa     Download sequence    Send to blast
MHTKRDSKIS HRKKHKPKLK SHIKTTGSSF SKRKDNESLN KRTRNGPTNR KLIGRKILHK  60
SPDTESSKKL SSLRLQSEKL AHGSCEGNGE TADGDIEIKK LRRRRKRKRR KLNVELDEAS  120
RLQRRTRYLL IKMKQEQSLI DAYSGEGWKG QSREKIKPEK ELQRANKQIL KCKLGIRDVI  180
RQLDLLSSVG SIEDSVIAPD GSVYHEHIFC AKCKLRDAFP DNDIILCDGT CNSAFHQKCL  240
DPPLDTENIP PGDQGWFCRF CDCKMEMLEA VNAHLGTHFS MNSNWQDVFK EEAAFPDGAN  300
SLLNPDEEWP SDDSEDDDYN PDRRENSCSI SGAATGDDVS DDELSSNSSA ASGESTDAEI  360
ICSRRQRRDV DYKKLYDEMF GKEALPYEQI SEDEDWGPAK KRRREKESDA ASTLMTLYES  420
DKKCSDVDVG EVERKLPQET RIRRSFFRIP HNAVERLREV FAENELPSRA VKENLSKELG  480
LDPEKVSKWF KNARYLALKT RKAERQKLHS FTSGNSKDSG CENFNKDSAD LVASEDTSTE  540
TVIHNPKDVK VSCQRKHRRT LSSPVKKRQP KESSVRLPAN NSKETLEFSD DVSLKKLLKA  600
RTKEKKKVNF ITVGECRAAE EEMERLCKIK DRLENLKQKL LEFKNDKAKN SVKPSLNGRS  660
VIYVPVAELR EKA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
198111KKLRRRRKRKRRKL
2101107RRRRKRK
3102110RRRKRKRRK
4103108RRKRKR
5104109RKRKRR
6104110RKRKRRK
7104111RKRKRRKL
8105110KRKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015893988.10.0PREDICTED: pathogenesis-related homeodomain protein isoform X2
SwissprotP487851e-166PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLM5XHZ30.0M5XHZ3_PRUPE; Uncharacterized protein
STRINGVIT_11s0103g00650.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.21e-162pathogenesis related homeodomain protein A