PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015893626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family NAC
Protein Properties Length: 215aa    MW: 24506.8 Da    PI: 9.9113
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015893626.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.66.9e-4291281128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF Ptdeelvv++L++k++  +++  +vi+++d+y ++PwdL  k+ +e ++wyfFs++ +       ++r+t++gyWka g +++vls+
  XP_015893626.1   9 LPPGFRFYPTDEELVVHFLHRKASLLPCHP-DVIPDLDLYPYDPWDLTGKALEEGNQWYFFSRKTQ-------NERVTNNGYWKAMGIEEAVLSS 95 
                     79*************************999.99**************977777899*****99754.......689******************* PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +g+ vg+kk Lvfy g++p+g kt+W+mhey+l
  XP_015893626.1  96 SGRRVGTKKYLVFYLGESPSGIKTNWIMHEYHL 128
                     ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-496134IPR003441NAC domain
PROSITE profilePS5100545.8299155IPR003441NAC domain
PfamPF023654.7E-2510128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGDHNNVNLP PGFRFYPTDE ELVVHFLHRK ASLLPCHPDV IPDLDLYPYD PWDLTGKALE  60
EGNQWYFFSR KTQNERVTNN GYWKAMGIEE AVLSSSGRRV GTKKYLVFYL GESPSGIKTN  120
WIMHEYHLSD SASSSSSRSS SKGRSTKKIV KLWRKGINGT SSAEKLRTKG LRIMGTGKQW  180
ELRKLFSQAP VEELEQRNTW CSTWGNLLPA LKPIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-41513716154NAC domain-containing protein 19
3swm_B9e-41513716154NAC domain-containing protein 19
3swm_C9e-41513716154NAC domain-containing protein 19
3swm_D9e-41513716154NAC domain-containing protein 19
3swp_A9e-41513716154NAC domain-containing protein 19
3swp_B9e-41513716154NAC domain-containing protein 19
3swp_C9e-41513716154NAC domain-containing protein 19
3swp_D9e-41513716154NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015893626.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024933511.11e-109NAC domain-containing protein 104
SwissprotQ8GWK63e-61NC104_ARATH; NAC domain-containing protein 104
TrEMBLW9RXQ86e-72W9RXQ8_9ROSA; NAC domain-containing protein 68
STRINGXP_010103879.11e-72(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.11e-50xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]