PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015893088.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Nin-like
Protein Properties Length: 941aa    MW: 104916 Da    PI: 6.2482
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015893088.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.43.4e-29625675252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek isl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  XP_015893088.1 625 EKAISLQVLQQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 675
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.029614695IPR003035RWP-RK domain
PfamPF020425.9E-25628675IPR003035RWP-RK domain
SuperFamilySSF542771.43E-21836926No hitNo description
Gene3DG3DSA:3.10.20.2404.1E-21844924No hitNo description
PROSITE profilePS5174523.7845928IPR000270PB1 domain
SMARTSM006663.3E-25845928IPR000270PB1 domain
CDDcd064072.48E-36846926No hitNo description
PfamPF005641.4E-16847927IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 941 aa     Download sequence    Send to blast
MSMEYYGAML PNSTYGNFPN TTSTTTTNAE EDFMDELLFE GCWLESSSGF NFMQPFSSNP  60
HPLVVDPWHY LPSFESNSAL SNMNPHHQIY QQDHTADQGS LTENHHENYN CFVIESSSNS  120
RSSGNGNGGH IGGSRLWIGP RAYPNPSSSV KERLMLAIGH LKECTKHMDV LIQIWVPVRK  180
GGKQMLTTYD HPYYLNTNCK SLENYQLLTE EDSTESVRLP HRTFLGKLPE WKPDVRFFQS  240
YEYPRVNYGQ QHDVRGSLAV PIFERGSGTC LGVIEIVMTT QMVNYRPEEY VFQALEAVDL  300
RSSQNFIPPN IEACDELYQA ALSEIVEVLT SVCKTNRLPL ALTWAPCVQQ GKGGCRHSDV  360
NYARCVSTVD SACLVIDLEI LGFHEACSKH HLFRGQGIVG TAFSTSKTCF ATDITAFSKT  420
EYPLSHYARM FGVHAAVAIP LRTVYTGSSD FVLEFFLPQD CHDPEEQKQM LNSLPIVIRQ  480
ACRSLYVVDD KEPEEVMQPI RETIVLSDLR LGKEESLNLG PPSEETSEKE SSWIAHMEAQ  540
QQGRCLSVLL DYQMEEPKEE LKGTTHWDSN QGGLPNGQVF TDFRQLKQSS GHKVSVEGGG  600
NSYSFGGHCS SGGRKAGRRR HTKTEKAISL QVLQQYFAGS LKDAAKSIGV CPTTLKRICR  660
QHGITRWPSR KIKKVGHSLR KLQLVIDSVP GAEGAIQIGS FYPTFQELSF PKFQESDPFT  720
SMKSSNQSKQ LNSQSESGLF SQGGTTKSPS ALCSQTSGLS VCAAEAKQHI TNINGISCTD  780
ALMAKDPVGM LKRDCSDGKL LACNLEETKI LPRSQSYKAL SKNQTLESLH PMLGSSGWNF  840
CDGGALRVEA YFGDEKIRFT LQSNHSFGDL QLEIARRFNL DDISTIDIKY LDDDHEWVLL  900
TCNADLEECM EIYKSSQSHT LQLSLQRAPF PNQGSSFGSS S
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015893088.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015893088.10.0protein NLP2-like
TrEMBLA0A221I0T00.0A0A221I0T0_9ROSA; Nodule inception protein
STRINGXP_008235979.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein