PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015892651.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family WRKY
Protein Properties Length: 521aa    MW: 57263.1 Da    PI: 4.8691
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015892651.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.86e-25208264259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk+ + +rsYY+Ct+++C +kk +e++++ ++v+ei+Y+++H+h+
  XP_015892651.1 208 SDGYNWRKYGQKQVKSPKGSRSYYKCTYSECFAKK-IECCDHSGHVTEIVYKNQHTHD 264
                     7********************************98.*********************7 PP

2WRKY97.11.1e-30384440359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  XP_015892651.1 384 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVDNTNAVVITYKGIHDHD 440
                     9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081117.27202266IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-21205266IPR003657WRKY domain
SuperFamilySSF1182905.23E-20207266IPR003657WRKY domain
SMARTSM007742.3E-24207265IPR003657WRKY domain
PfamPF031062.2E-17209264IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-31367442IPR003657WRKY domain
PROSITE profilePS5081131.72377442IPR003657WRKY domain
SuperFamilySSF1182905.36E-27378442IPR003657WRKY domain
SMARTSM007747.7E-35382441IPR003657WRKY domain
PfamPF031065.4E-23384439IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MAEQQSFKAP EAENTKTTNE QVEEEEEPEE DDEDELEGGD EDDEEEAEEE EVGGDGGGEL  60
QVGEFQSSEQ LVEVEVKQSA VETLAVPSSE DDQRAVLLMN STSQSNAGAQ FEEQVTEPQP  120
EVLASVAPQD ARAKTENRQQ FSACPAPLSE LSPTSVTQSI SAAPSPTLLE QRLSPPKVTG  180
SCMLEADQHN SLDVKTLPSI PVLKSAASDG YNWRKYGQKQ VKSPKGSRSY YKCTYSECFA  240
KKIECCDHSG HVTEIVYKNQ HTHDPPRKSN CTRESKLSLA TERVLGNNVT EHQQSSRTLN  300
DSDPSTSSKE LTHETLPLPE RKRQNSITPE ENGDIKVKEE HGNEPEPKRR MKKSNVEYPG  360
SLLKPGKKPK FVVHAAGDVG ISGDGYRWRK YGQKMVKGNP HPRNYYRCTS AGCPVRKHIE  420
TAVDNTNAVV ITYKGIHDHD MPVPKKRHGP PSAPLVAAAA PASMSNLQLK KTETHQNQTS  480
STQWSVDNEG ELTGEALDLG GEKAMESART LLSIGFEIKP C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-24373442877Probable WRKY transcription factor 4
2ayd_A1e-24370442274WRKY transcription factor 1
2lex_A1e-24373442877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015892651.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-137WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLM5W7R30.0M5W7R3_PRUPE; Uncharacterized protein
STRINGVIT_11s0037g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-123WRKY DNA-binding protein 32