PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015892554.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GATA
Protein Properties Length: 333aa    MW: 36978.1 Da    PI: 5.1899
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015892554.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.83e-18241274134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  XP_015892554.1 241 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 274
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.7E-874330IPR016679Transcription factor, GATA, plant
SMARTSM004014.8E-13235289IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.53235271IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-14238298No hitNo description
Gene3DG3DSA:3.30.50.101.7E-14239272IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.67E-14240289No hitNo description
PfamPF003204.2E-16241274IPR000679Zinc finger, GATA-type
PROSITE patternPS003440241266IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEGMEAIALK PSLRRELHQQ VFFEEFYGAT GITCVSTEDF SVDDLLDLPN GEFEDGSYEE  60
EEEKDSVSLD ENSNSSNFST AGDSESPLTS ELAVPDDDIA ELEWVSHFVD DSLSDLPLLY  120
PVGKQRSETC TEDRSVKKPR LTEPNPPLCF PSVPVKARTK RSRPTGRTWS RGNSLAESSS  180
SSSSSLSSGF SSTPTLIFAS TVQNMEFFQN FEKPAPKKQK KKPAVQTNGS SGGTIQSQRR  240
CSHCQVQKTP QWRTGPLGAK TLCNACGVRY KSGRLFPEYR PACSPTFSGE LHSNSHRKVL  300
EMRKRKETAE TKSELTQEMA EIKSELTQMI PSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1215222PKKQKKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015892554.10.0PREDICTED: GATA transcription factor 5
TrEMBLD9ZIZ01e-108D9ZIZ0_MALDO; GATA domain class transcription factor
STRINGPOPTR_0009s12620.14e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-53GATA transcription factor 5