PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015891991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HB-other
Protein Properties Length: 997aa    MW: 111300 Da    PI: 9.5375
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015891991.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.95.3e-0669125157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++ ++ ++++F+ +  +s++e +e+++  g+t +qV+ +F  +R + +k
  XP_015891991.1  69 KRPRDLLNPKAVKYMQSVFAIKDAISKKESREISALYGVTVTQVREFFTSQRSRVRK 125
                     799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.68566126IPR001356Homeobox domain
SuperFamilySSF466891.75E-668128IPR009057Homeodomain-like
SMARTSM003892.0E-468130IPR001356Homeobox domain
CDDcd000861.35E-469125No hitNo description
Gene3DG3DSA:1.10.10.608.0E-669133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 997 aa     Download sequence    Send to blast
MEALKEDFSE LEIGSSAQSF QKFLNSQREL FHSQIDQLQK IVVTQCQLTG VNPLSQEMAA  60
GALSINIGKR PRDLLNPKAV KYMQSVFAIK DAISKKESRE ISALYGVTVT QVREFFTSQR  120
SRVRKVVRLS REKTIRSNEY TEPHDGISAT SGALMPIDPV PLNTVVPTSV EEAPSCSTQD  180
DALPGIDDLD KQFVENIFTL MRKEETFSGQ VKLMEWILRI QNSTVLCWFL NKGGVMILAT  240
WLSQAATEEQ TTVLFVILKV LCHLPLHKAV PVHMSAVLQS VNRLRFYRTS DISNRARVLL  300
ARLSKLLARS QALKKPNGMK SSSDAQQELM LKQSIDDVVG YEPWQSNIDF TGNILASPYD  360
SSENFRKSEP MQTLKLLPAS SDDSNKKQVL GITQIKERRK VQMVEQPGQK TAGRSTQAAR  420
AAPISQGRPM SADDIQKAKM RAQWMQSKYG KAGSSNSNKE AKIQSSNKSS TSQASILPLA  480
SKVPVRPNIE EQKKPVSLLS KVPNILEASL DQKMIADSKE PWWEKCRRVQ KLWQTPPEIK  540
LNHQWSVGAG ENSKEVEVQK NRNNREKETI YQRIQEIPSN PKEPWDLEMD YDDTLTPEIP  600
TQQLPDADNT ETQATNQAIN NVGTQGAPSQ RVNNYASLQS ITTSQTGSTS IAEPDLELLA  660
VLLKNPELVF ALTSGQASNL SSEETVKLLD MIKAGGSGLT SNMNGLDRQG EDNIGVSLPS  720
PTPSSNPGTT GWRQEAVRNP FSQQTVLPNR ATYISSEVAT ANSVPPPHIS AAHISSLRQS  780
ASIPPYSHQT PASDVVMKNS PLTVTPFHNL HSASLPSMRV ESTSSVKPSL ISNAEERQRF  840
PIPSNTLLPT TARPQIHPQQ QQLLSGPSDP YTPVYSKQIG KPNPASESWR TTQGLPSFYR  900
PLNQNNYNAS LVGPEQPQLM SGPKWEGNEY VEEDDFESWS PDNSPVRNPE YMMGRSFPDA  960
RTNPGREYRP ERMRQRNSSG YRDQNRYGNR RWRDRRR
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015891991.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015891991.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2I4FUX10.0A0A2I4FUX1_JUGRE; homeobox protein LUMINIDEPENDENS isoform X2
STRINGXP_008235014.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-157HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]